KEGG   Bacillus pumilus SAFR-032: BPUM_0514Help
Entry
BPUM_0514         CDS       T00599                                 

Definition
(GenBank) isochorismatase
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: ABV61209
UniProt: A8FAE2
Position
complement(27442..27960)
Genome map
AA seq 172 aa AA seqDB search
MINNFDFEMGHVLADKTEQMTNKILALKDHAFKENWPIIYINDHYGLWKADIQAVMETCK
NERSSAILEKMAPSKDDYFLIKPKHSAFYGTALETLLNELGVQDIILTGIAGNICVLFTA
NDAYMREYNLIVPKDCIASNDDRDNEYALTMMENVLLAKITTAKEITNENQT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattaataattttgactttgaaatgggacatgtactcgctgataaaacagagcaaatg
accaataagattttagctcttaaagatcatgctttcaaggaaaattggccgatcatctat
atcaacgaccactatggtctctggaaggctgatattcaagctgtgatggaaacatgcaaa
aacgagagaagctccgctattttagagaaaatggcaccatcaaaagatgattatttctta
attaaaccgaagcattctgccttctatggtactgcattagagacactcttaaatgaatta
ggtgtacaagacatcattttgaccggaattgcaggaaacatttgcgttctattcactgca
aatgacgcatacatgcgagaatacaacttaattgtacctaaagattgtatcgcatcaaat
gacgacagagacaacgaatatgctttaacgatgatggaaaacgttctacttgcaaaaatc
accactgctaaagagatcacgaatgaaaatcaaacatga

DBGET integrated database retrieval system