KEGG   Bacillus pumilus SAFR-032: BPUM_0834Help
Entry
BPUM_0834         CDS       T00599                                 

Definition
fructose-2,6-bisphosphate 2-phosphatase (EC:3.1.3.46)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPUM_0834
   01230 Biosynthesis of amino acids
    BPUM_0834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_0834
  Energy metabolism
   00680 Methane metabolism
    BPUM_0834
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_0834
Enzymes [BR:bpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPUM_0834
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPUM_0834
  Exosomal proteins of melanoma cells
   BPUM_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(915024..915581)
Genome map
AA seq 185 aa AA seqDB search
MKTYYIVRHCQANGQSEDASLTLQGIAQSHALAQFFSSIHLNQIISSPYKRAIQTSEPLA
HAKQLEVKIDQRLAERVLSSKPMDNWYEKLKHSFTDLHLTCEGGESSLEAMNRIVEVLYE
QINSEKDHTLFVTHGNIMSLLLKHADATIGFKEWEKLSNPDVYVLTYFKPDHVEIERIWH
KETAE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatattatatcgttagacactgccaagccaatggacaatccgaggatgcgtct
ttaacactacaaggcatcgcacaatctcacgcactagcacagttcttttccagcatccat
ctcaatcagatcatctcaagtccctataagcgagcgatccaaacatctgagcctcttgct
catgcaaaacaactcgaagtgaaaattgatcaacgcctcgctgaacgtgtgctaagcagc
aaaccaatggacaattggtatgagaaactaaagcacagttttacggacttacatttgact
tgtgagggcggagaatcaagccttgaagccatgaatcgcattgtagaagtactctacgaa
caaataaattcagaaaaagatcatacgctatttgtcacacatggcaatatcatgagcttg
cttcttaaacacgccgatgccacgattggattcaaagagtgggagaaactaagcaatcca
gatgtctatgtcctgacatatttcaaaccagatcatgtagaaatagagcgaatatggcat
aaagaaacggcagaatga

DBGET integrated database retrieval system