KEGG   Bacillus pumilus SAFR-032: BPUM_0834Help
Entry
BPUM_0834         CDS       T00599                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00010  Glycolysis / Gluconeogenesis
bpu00260  Glycine, serine and threonine metabolism
bpu00680  Methane metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
bpu01230  Biosynthesis of amino acids
Module
bpu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpu_M00002  Glycolysis, core module involving three-carbon compounds
bpu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_0834
  Energy metabolism
   00680 Methane metabolism
    BPUM_0834
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_0834
Enzymes [BR:bpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPUM_0834
Membrane trafficking [BR:bpu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPUM_0834
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPUM_0834
  Exosomal proteins of melanoma cells
   BPUM_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF763 Fer4_12
Motif
Other DBs
NCBI-ProteinID: ABV61518
UniProt: A8FBA1
Position
complement(915201..915758)
Genome map
AA seq 185 aa AA seqDB search
MKTYYIVRHCQANGQSEDASLTLQGIAQSHALAQFFSSIHLNQIISSPYKRAIQTSEPLA
HAKQLEVKIDQRLAERVLSSKPMDNWYEKLKHSFTDLHLTCEGGESSLEAMNRIVEVLYE
QINSEKDHTLFVTHGNIMSLLLKHADATIGFKEWEKLSNPDVYVLTYFKPDHVEIERIWH
KETAE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatattatatcgttagacactgccaagccaatggacaatccgaggatgcgtct
ttaacactacaaggcatcgcacaatctcacgcactagcacagttcttttccagcatccat
ctcaatcagatcatctcaagtccctataagcgagcgatccaaacatctgagcctcttgct
catgcaaaacaactcgaagtgaaaattgatcaacgcctcgctgaacgtgtgctaagcagc
aaaccaatggacaattggtatgagaaactaaagcacagttttacggacttacatttgact
tgtgagggcggagaatcaagccttgaagccatgaatcgcattgtagaagtactctacgaa
caaataaattcagaaaaagatcatacgctatttgtcacacatggcaatatcatgagcttg
cttcttaaacacgccgatgccacgattggattcaaagagtgggagaaactaagcaatcca
gatgtctatgtcctgacatatttcaaaccagatcatgtagaaatagagcgaatatggcat
aaagaaacggcagaatga

DBGET integrated database retrieval system