KEGG   Bacillus pumilus SAFR-032: BPUM_0834Help
Entry
BPUM_0834         CDS       T00599                                 

Definition
fructose-2,6-bisphosphate 2-phosphatase (EC:3.1.3.46)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPUM_0834
   01230 Biosynthesis of amino acids
    BPUM_0834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_0834
  Energy metabolism
   00680 Methane metabolism
    BPUM_0834
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_0834
Enzymes [BR:bpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPUM_0834
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPUM_0834
  Exosomal proteins of melanoma cells
   BPUM_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(915024..915581)
Genome map
AA seq 185 aa AA seqDB search
MKTYYIVRHCQANGQSEDASLTLQGIAQSHALAQFFSSIHLNQIISSPYKRAIQTSEPLA
HAKQLEVKIDQRLAERVLSSKPMDNWYEKLKHSFTDLHLTCEGGESSLEAMNRIVEVLYE
QINSEKDHTLFVTHGNIMSLLLKHADATIGFKEWEKLSNPDVYVLTYFKPDHVEIERIWH
KETAE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatattatatcgttagacactgccaagccaatggacaatccgaggatgcgtct
ttaacactacaaggcatcgcacaatctcacgcactagcacagttcttttccagcatccat
ctcaatcagatcatctcaagtccctataagcgagcgatccaaacatctgagcctcttgct
catgcaaaacaactcgaagtgaaaattgatcaacgcctcgctgaacgtgtgctaagcagc
aaaccaatggacaattggtatgagaaactaaagcacagttttacggacttacatttgact
tgtgagggcggagaatcaagccttgaagccatgaatcgcattgtagaagtactctacgaa
caaataaattcagaaaaagatcatacgctatttgtcacacatggcaatatcatgagcttg
cttcttaaacacgccgatgccacgattggattcaaagagtgggagaaactaagcaatcca
gatgtctatgtcctgacatatttcaaaccagatcatgtagaaatagagcgaatatggcat
aaagaaacggcagaatga

DBGET integrated database retrieval system