KEGG   Bacillus pumilus SAFR-032: BPUM_0972Help
Entry
BPUM_0972         CDS       T00599                                 

Definition
(GenBank) peptidase S8
  KO
K01342  
subtilisin [EC:3.4.21.62]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BPUM_0972
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BPUM_0972
Peptidases [BR:bpu01002]
 Serine Peptidases
  Family S8: subtilisin family
   BPUM_0972
Chaperones and folding catalysts [BR:bpu03110]
 Intramolecular chaperones
  Subtilisin family
   BPUM_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1050332..1051477)
Genome map
AA seq 381 aa AA seqDB search
MKKKNVMTSVLLAVPLLFSAGFGGSMANAETVSKSDSEKSYIVGFKASATTNSSKKQAVT
QNGGKLEKQYRLINAAQVKMSEQAAKKLEHDPSIAYVEEDHKAEAYAQTVPYGIPQIKAP
AVHAQGYKGANVKVAVLDTGIHAAHPDLNVAGGASFVPSEPNATQDFQSHGTHVAGTIAA
LDNTIGVLGVAPSASLYAVKVLDRYGDGQYSWIISGIEWAVANNMDVINMSLGGPNGSTA
LKNAVDTANNRGVVVVAAAGNSGSTGSTSTVGYPAKYDSTIAVANVNSSNVRNSSSSAGP
ELDVSAPGTSILSTVPSSGYTSYTGTSMASPHVAGAAALILSKYPNLSTTQVRQRLENTA
TPLGNSFYYGKGLINVQAASN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaaaaatgtgatgacaagtgttttattggctgtccctcttctgttttcagca
ggatttggaggctccatggcaaatgccgagacggtctcaaagtcagatagtgaaaagagc
tatattgttggctttaaagcctccgccaccacaaacagctctaagaaacaagccgtcact
caaaatggtggaaaactagaaaagcaatatcgtctcattaatgccgcacaagtaaagatg
tcagaacaagccgcgaaaaaacttgaacatgaccctagcattgcttacgtagaagaagac
cacaaagcagaagcatatgcacaaaccgtcccttatggaatccctcaaatcaaagctcca
gctgtacacgctcaaggttataaaggtgctaatgtcaaagtagctgtccttgatactggc
atccacgctgcacaccctgacttaaatgttgcaggcggtgccagcttcgtcccttcagag
ccaaatgccacccaagactttcaatcacatggaactcacgtagccggaacgatcgctgcc
cttgataacacaattggtgttcttggggtcgctccaagtgcctccctatatgctgtgaaa
gtattagaccgctatggcgacggacaatatagctggatcattagcggtattgaatgggca
gtagccaataatatggatgtcatcaacatgagcttaggcggaccaaacggttcaacagca
cttaaaaatgccgttgatacagcgaataaccgcggagtcgttgttgtggcggctgcaggt
aactcaggttctactggttctacaagtacagttggctatccagcaaaatatgattctacc
attgccgttgctaatgtgaacagcagtaatgtcagaaactcgtcttccagcgcaggtcct
gaattagatgtttctgcacctggtacttctattttaagtacagtaccaagcagtggatac
acatcttatactggaacatctatggcgtctcctcatgtagcaggagcagcagcgcttatt
ctttctaaatacccgaatctatcaactactcaggttcgccagcgcttagaaaacacagca
acaccgcttggtaactccttctattacggaaaagggttaatcaacgttcaagcggcttct
aactaa

DBGET integrated database retrieval system