KEGG   Bacillus pumilus SAFR-032: BPUM_1010Help
Entry
BPUM_1010         CDS       T00599                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPUM_1010
Enzymes [BR:bpu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BPUM_1010
Peptidases [BR:bpu01002]
 Cysteine Peptidases
  Family C44
   BPUM_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1091978..1093819
Genome map
AA seq 613 aa AA seqDB search
MCGITGWADFKKQLIQQDHVINQMTDTLSKRGPDDTNTWKSEHVLFGHKRLAVVDVEGGK
QPMTYTHQNHAYTVVYNGELYNTEDIRKELLKRGHRFLGHSDTEVLLHAYTEWKEECVTH
FNGIFAFVIWDSERELLFAGRDRLGVKPFFYTERHHSFLFGSEIKALLAHPDMKAKVDHE
GLSEIFGLGPSRTPGQGVFKGVKELRPAHALTFSKDGLRVWRYWNVKSRVHTDSLDDTAQ
NVKDLFTDAVTRQLVSDVPVCTFLSGGVDSSAITAIAAKHFEKIGKAPLHTYSVDYEGND
QFFEASHFQPNADGPWIDRMTKAFQTNHHNCIIGQKELAAYLKEAVEVRDLPGMADIDSS
LLWFCREIKKDFVVGLSGECADEIFGGYPWFHSASETNGFPWMRSTEARTQLLQDSWQKK
LSLKEYAQSKYEETVAETPLLDGETGVDKARRELFYLNMVWFMTTLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMYGNREKGVLRKALEGILPDEVLYRKKSPYPKTHHPAY
THAVKEMLTDCLAQKDSVLHEFLDPNQLKQLIETEGASFQVPWYGQLMKGPQLIAHLAQI
HHWFETYRIDIEA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacaggctgggcagactttaaaaagcagctcatccaacaggatcatgta
atcaatcaaatgacagatacattatctaaaagagggccagacgatacaaatacgtggaaa
agtgagcacgttttatttgggcataaaaggttagcggttgtagatgtagaaggcggaaaa
cagccgatgacatatacacatcaaaaccatgcttataccgttgtatacaatggagagctc
tataacacagaggatataagaaaagaattgttaaaaaggggccaccgctttcttgggcat
tctgatacagaggtgcttcttcacgcctacacagaatggaaggaagagtgtgtgacccat
tttaatggtatttttgcatttgtcatttgggatagtgagcgtgaattattatttgcaggg
agagaccggctcggcgtcaagccatttttctatacagaacgtcatcattcctttttattt
ggttcagaaatcaaagcgcttcttgctcaccctgatatgaaagcaaaagtcgatcatgag
ggattatcggagatttttggtttaggaccgtctagaacaccagggcaaggagtgtttaaa
ggggtaaaagagctgagacctgctcatgccttgaccttttcaaaagacggattgcgtgtg
tggagatactggaatgtcaaaagcagggtgcatacggactcacttgatgacaccgcacag
aacgtcaaggacctctttacagatgccgtcacaaggcagctcgtctctgatgtgcctgtt
tgtacatttttatcgggtggcgtcgattcgagtgctattaccgccattgccgctaagcac
tttgagaaaatagggaaagcaccacttcatacgtattccgttgactatgaagggaatgat
caattttttgaagcaagtcatttccagccgaatgcggacggtccatggattgaccgcatg
accaaggcgtttcaaacgaatcatcacaactgcatcattggacaaaaggagttggctgct
tatttaaaggaagcggttgaggtccgagacttaccgggtatggcagatattgattcttcc
ttgctttggttctgtcgtgaaattaaaaaggactttgtggttggtttgtcaggtgaatgt
gcggatgaaatttttggaggttatccttggttccattctgcaagtgaaacgaatggtttt
ccttggatgagatcgacggaagctagaacgcagctcttacaagactcgtggcaaaaaaag
ctgtcactaaaagaatatgcacaaagcaagtatgaagaaaccgtggctgaaacacctctt
ttagatggagaaactggagtagataaagcccggagagaacttttttacttaaatatggtc
tggtttatgacaacgttgctagatcgaaaagaccgaatgagtatgggtgcgagccttgag
gtacgtgtgccatttgcggaccatcgccttgtcgaatatgtatggaatattccttgggaa
atgaaaatgtatggaaatcgtgaaaaaggggttttacggaaagcattagagggaatttta
ccggatgaagtgctttatcgcaagaagagtccttatccgaaaacacatcatccagcctat
acccatgctgtgaaagagatgttaacagattgccttgcgcaaaaagattctgtccttcac
gaatttctagatccgaatcaattaaagcagttgattgaaacggaaggagcttcctttcaa
gtcccttggtatggtcagctcatgaagggcccgcaattaatcgctcatctggcgcaaatt
catcattggtttgagacgtatcgaattgatatagaagcgtaa

DBGET integrated database retrieval system