KEGG   Bacillus pumilus: BPUM_1207Help
Entry
BPUM_1207         CDS       T00599                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bpu  Bacillus pumilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1273273..1274370
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVIKIGSSSLTEQKGAIDEQKMQDHVRAIAKLKEAGHEIILISSGAVAAGFGSLG
YPSRPVTLKGKQAAAAVGQGLLMQKYTELFSQFHMTPAQMLLTRNDFSDRTRYRNAYATM
MELLERKILPIINENDSVSIEELTFGDNDMLSALVSGLIHADQLIILTDINGIYNANPNE
HPDAKRFDVLTHISEELFSYAKSTGSKVGTGGMKSKLSAAQTALSLGVKVFIGTGTGEDK
LLHILAGQGDGTYIGEQDLSAVNNRRQWIQFHSPVSGKIMIDAGAEAAILHHGRSLLPAG
VIDVAGDFSKGEVVEVVGPNGLVGKGQTLYASDELHGIKGLRSDELSNEKPEVIHRDHWV
QHVQN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcaaaggatcgtcatcaaaattggcagtagttcattgacagagcaaaaagga
gccattgatgaacaaaaaatgcaagatcatgtgagagcgatagcaaagctgaaagaggct
ggacatgaaatcattttaatttcatcaggagccgtcgcagcagggtttggcagcttaggg
tacccatcaagacctgtgaccttaaagggaaaacaggcagccgccgccgttggtcagggc
ttgttaatgcagaaatatacagaactattttcacagttccacatgacacctgctcaaatg
cttttaacccgtaatgacttttcagatcgtacaagatatcgcaatgcttacgcaacgatg
atggagctactggaaagaaaaattttaccgattattaatgaaaatgattctgtttctatt
gaggagcttacctttggtgataatgatatgctgtcagctcttgtcagcggtttaattcat
gcagatcaattgatcatcttaacagacattaacggaatttataatgcaaatccaaatgag
catcctgacgcaaagcgttttgatgtcctaacacacatttcagaagaattgttttcatat
gcgaagagcacaggctcaaaagtggggacaggcgggatgaaatcaaagctgtctgctgca
caaacggcactttcactaggcgtgaaagtcttcattggtacaggtactggtgaggataag
ctgcttcatattctagcaggtcaaggagacggaacgtatatcggagaacaggacttatca
gctgttaacaaccgccgtcaatggattcaattccattcacccgtttctgggaaaatcatg
atagatgcaggagcagaagcagcgattttgcatcatggcagaagtcttcttccagctggt
gtcattgatgtcgctggtgacttttctaaaggagaggtcgttgaagtcgtcggtccaaac
ggactagtaggtaaaggacaaaccttgtacgcatccgatgaacttcacggtattaaagga
ctgcgaagtgatgagctttctaatgaaaagcctgaagttatacacagagatcactgggta
cagcatgtacaaaactga

DBGET integrated database retrieval system