KEGG   Bacillus pumilus: BPUM_1374Help
Entry
BPUM_1374         CDS       T00599                                 

Gene name
gls
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpu  Bacillus pumilus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpu00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bpu00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427787..1428716
Genome map
AA seq 309 aa AA seqDB search
MACRDNEELQRFVEEAKKVAKDGQVASYIPALGKADQTDLSVAVYHVSNTCHSAGDVDKR
FTLQSISKVLALALVLSEEGPKKVFQFVGQEPTGDPFNSMIKLETASPNKPLNPMINAGA
LAVTSLIRGATPEAQLGRLLSFIRELANDKSITYCKETAASEFETSMINRAMCYYMKQYH
IIRGNVEEVMDVYTKQCAIMMNSLDLAKIACVFSLDGRHPETGKQILSKDVARICKTFMV
TCGMYNASGEFAINIGIPAKSGVSGGIMGAAPYDFGIGIFGPALDEKGNSIAGIKLLELM
SEKYEMSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtcgcgacaatgaagagcttcagcgatttgtagaagaagcaaaaaaagtggcc
aaagatggtcaagtagcatcctatattcctgctctcggcaaagcggatcagacggattta
tctgtggctgtgtatcatgtgagtaatacgtgccactccgctggggatgtagataaacga
tttacgcttcaaagcatttcaaaagtattagcactggcgcttgtgctctcagaagaaggg
ccaaaaaaagtctttcaatttgttggacaagaaccaacaggagacccgtttaattcaatg
atcaaactggaaacagccagcccgaataaaccgctgaatccaatgattaatgcaggggcg
ctcgccgtcacaagtttaatcaggggagcgaccccagaagctcagctgggccggttgctt
agcttcattagagagcttgcaaatgacaaaagcattacatactgcaaggaaaccgctgcg
tccgaatttgagacatccatgattaaccgggcgatgtgctattatatgaagcaatatcat
attattagagggaacgtagaagaagtcatggacgtctatacgaaacaatgtgccatcatg
atgaacagcttggatttggcgaaaattgcttgtgttttttcattagacggcaggcaccca
gaaacgggaaagcaaattctttcgaaagatgtcgctagaatttgtaaaacctttatggtg
acgtgcggcatgtacaatgcgagcggagaatttgccattaacatcggaattcctgcaaaa
agcggtgtctcaggtgggattatgggagctgcaccatatgattttggaatcggtatcttc
ggtccggctctggatgaaaaagggaatagtattgctgggattaagctgcttgagctgatg
agtgaaaaatacgagatgagtatcttttaa

DBGET integrated database retrieval system