KEGG   Bacillus pumilus SAFR-032: BPUM_1448Help
Entry
BPUM_1448         CDS       T00599                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPUM_1448 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPUM_1448 (pyrB)
Enzymes [BR:bpu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BPUM_1448 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501353..1502276
Genome map
AA seq 307 aa AA seqDB search
MNDLSTMSSLTKEEILQLIEEATALKKGKQELGLAGEFVANLFFEPSTRTRFSFEVAEKK
LGMNVLSLDAASTSVQKGETLYDTVKTLESIGVKACVIRDSTDEYYNELIGKVGIPIINA
GDGCGQHPTQSLLDLMTIYEEFGGFEGLTISIHGDIKHSRVARSNAEVLSRLGATVLFSG
PASFQDEQNPHGTYVQVDEAIKQSDVVMLLRIQHERHTEKMGNEDYLSTYGLTVNRAKNM
KERAIIMHPAPVNRGVEIDDSLVESKQSRIFKQMENGVYVRMAVLKRAFQNSKLHQKGRE
SVYVVSH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatctatcgacaatgagtagcttaactaaagaagagattttacagctgattgaa
gaagcaacagctctcaaaaagggtaagcaagaacttggtttagcaggagaatttgtagca
aacctcttctttgaaccaagtacaagaacacgatttagcttcgaagtcgctgaaaagaaa
ctggggatgaatgtactgagcttagatgcggcaagcacctccgttcaaaaaggcgaaaca
ctatacgatacggtaaaaacgctcgaatccatcggcgtgaaagcttgtgtgatcagagac
agtacagatgaatactacaacgagctgattgggaaggtggggattcccatcatcaatgct
ggagatggctgcgggcagcacccgacccaatcactacttgacctaatgaccatctatgaa
gagtttggcggctttgagggcttaacgatttcaattcatggagacatcaagcacagcagg
gtggcaaggtcgaatgctgaagtgctctcaaggctgggggcgaccgtccttttctcaggg
cctgcttccttccaagatgagcaaaatcctcacggaacatatgtccaagtagacgaagcc
attaaacaatctgatgtagtgatgctacttagaatacagcatgaacggcacacggaaaaa
atgggcaatgaagattacttatcgacttatggattaacagtaaacagggcaaagaacatg
aaagaacgagccattattatgcatccagcaccagtaaatagaggtgtggagatagatgat
tctctcgtagaatcaaagcagtcacgaattttcaagcaaatggaaaatggtgtttatgtc
cgaatggcagtattaaaaagagcttttcaaaatagcaaactacatcaaaaagggagagag
tctgtctatgtcgtatctcattaa

DBGET integrated database retrieval system