KEGG   Bacillus pumilus SAFR-032: BPUM_1680Help
Entry
BPUM_1680         CDS       T00599                                 

Gene name
yrhJ
Definition
NADPH--hemoprotein reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BPUM_1680 (yrhJ)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BPUM_1680 (yrhJ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPUM_1680 (yrhJ)
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BPUM_1680 (yrhJ)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BPUM_1680 (yrhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1736097..1739240
Genome map
AA seq 1047 aa AA seqDB search
MQQTSIIPKPKTYGPFKNIPHIKKGELSQTFWRLADELGPIFQFEFSKATSIFVSSHELA
KEVFDESRFDKFIGSSLNKVRTFSGDGLFTSWTEEPNWRKAHHILMPAFSQQAMKGYHEM
MLDIATQLVQKWQRTGRDEEIEVAEDMTKLTLDTIGLCGFDFRFNSFYKENQHPFIESML
NGLNEAMEQASRLPVADKLMIKRRKKFEENVDFMKTLVDDIIQERRKQDKTGNDLLSLML
HAKDPETGERLSDENIRYQIITFLIAGHETTSGLLSFAIYFLLKNPEKLKKAVQEADDVL
QGELPTFKQVQKLTYTRMVLNEALRLWPTAPTFSLYAKEDTIIGGKYSIKKNQSVSVLLP
KLHRDQAVWGGDAEEFKPERFLHPEKIPQHAYKPFGNGQRACIGMQFALHEATMVLAMVL
HNMELIDHTSYELNLKESLTIKPNDFKIKVRPRKQQLFMAPPKEETKKSTTIEESKVKSH
GTPLLVLYGSNLGTAQQIANELAEDGKAKGFDMTTAPLDDYARQLPDKGAVLIVTASYNG
HPPDHAKTFVDWVTQDKEKDLTNVTFAVFGCGDRNWASTYQRIPRLIDEALESKGAKRVA
DLGEGDAGGDMDEDKETFQKIVFEQLAKEFQLTFQEKGKETPKLSVAYTNELVERPVAKT
YGAFSAVVLKNEELQSQKSERKTRHIELRLPEGKKYKEGDHIGIVPKNRDVLVQRVIDRF
NLDPKQHIKLSSEKEANHLPLGQPIQIRELLASHVELQEPATRTQLRELASYTVCPPHRV
ELEQMAGEAYQEAILKKRVTMLDLLDQYEACEMPFAHFLALLPGLKPRYYSISSSPKIDE
KRVSITVAVVKGKAWSGRGEYAGVASNYLCDLQKGEEVACFLHEAQAGFQLPPSSETPMI
MIGPGTGIAPFRGFVQAREVWQKEGKRLGEAHLYFGCRHPHEDDLYFEEMQLAAQKGVVH
IRRAYSRHKDQKVYVQHLLKEDGGMLIKLLDEGAYLYVCGDGKVMAPDVESTLIDLYQHE
KQCSKEDAENWLTTLANNNRYVKDVWS
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaacatcaatcattccaaaaccaaaaacatacggaccttttaaaaatattcct
catatcaaaaagggggagctttctcaaaccttttggcggctggcagacgaattaggaccg
atctttcaatttgaattttcaaaagcaacaagtatttttgtttccagccatgaacttgcc
aaagaagtatttgatgagagccgttttgataaattcatcgggagcagtctgaataaagta
agaacattttcaggggatgggttatttacaagctggacagaagaaccgaactggagaaag
gctcatcacatcttgatgccggcgtttagtcagcaggctatgaaggggtaccatgagatg
atgctcgatattgccacacagcttgtacaaaaatggcaaagaacaggccgtgatgaagaa
attgaagtagcagaggatatgacaaagctcactttagatacgattggactttgtggtttt
gacttcaggtttaacagcttttataaagaaaatcagcatcctttcatcgaaagcatgctg
aacgggttaaacgaagcgatggaacaagcaagtaggttgccggttgcagataaattaatg
atcaaaagaagaaaaaaatttgaagaaaatgtagattttatgaagacattagtagacgac
attattcaagaacggagaaaacaagataaaacgggcaatgatttactgtcccttatgctt
catgcaaaggaccctgaaacaggtgagcgcctgtcagatgaaaatattcgctatcaaatc
attaccttcttaatagctgggcacgaaacaacaagcgggctgttatcctttgcgatttat
ttcttattaaaaaatccagaaaaattaaagaaagccgtccaagaagcagatgatgtgctg
caaggcgaactgccaacatttaagcaggtacaaaaactaacttacactcgtatggtttta
aatgaagccctccgcctctggccaacagcgcctacgttctctctttatgcgaaagaggac
acaatcatcggagggaaatactcgattaaaaagaaccaaagtgtttccgttctactccct
aaattacaccgtgatcaagcggtatggggaggggatgcggaagaatttaaaccagagcgt
tttctgcaccctgaaaagatcccgcagcatgcctacaagccttttgggaatggacagcgt
gcatgtattggtatgcaatttgctcttcatgaagccactatggtactggcaatggtcttg
cacaacatggaattgattgatcacacatcatacgaacttaatttaaaagaatctttaacg
attaagccaaacgattttaaaatcaaagtgcggccaaggaagcagcaactctttatggca
ccgccgaaagaagaaacaaaaaaaagcaccaccattgaagagtctaaagtgaagagtcat
ggtacaccactacttgttttatatggatcaaatcttggtacagcgcagcaaatcgcaaac
gaattggctgaagacggaaaagcaaaaggatttgatatgaccacggctccgctcgatgac
tatgcgcgccaattaccagataagggtgcagttcttatcgtgaccgcttcatacaatgga
catccgcctgaccatgcgaaaacatttgtggattgggtcacgcaggataaagagaaggat
ttaacaaacgtgacatttgctgtgtttggatgcggggatcgaaattgggcaagtacctac
cagcgtattcctcgtctcattgatgaagcacttgaaagtaaaggggcaaagcgtgtagct
gatttaggagaaggtgacgcaggcggagatatggatgaggataaagaaacatttcagaaa
atagtcttcgagcagttagcaaaagaatttcagctcaccttccaagagaaagggaaggaa
accccaaaactatcagtagcttatacaaatgagctagtagaacgtcctgtggcgaaaaca
tatggtgccttttcagctgttgtactgaaaaatgaagaattacaatctcaaaaaagtgag
cggaaaacaagacatatagagttgcgactacctgaagggaaaaaatacaaagaaggggat
catatcggaattgttccgaaaaatcgtgatgtactcgttcagcgggtgattgatcgcttc
aatctagatcctaagcagcacatcaagctttcttctgagaaagaagcaaatcacttacct
ttaggtcagcccattcaaataagagaattacttgcgtcacatgttgagcttcaagaaccg
gcaacacgtacgcagctaagagagctcgcctcgtatacagtttgtccgcctcatcgcgtg
gagcttgagcaaatggctggtgaagcatatcaagaagctattttaaagaaacgagtcacc
atgctggatttactagatcaatatgaagcatgtgaaatgccatttgcgcactttttagca
cttttaccaggtttgaagcctcgttattattctatttctagctcaccaaagatcgatgag
aaaagagtcagtatcacagtggcggttgtgaaagggaaagcgtggagcggccgcggtgaa
tatgcaggagtcgcatcaaactatttatgcgatctgcaaaaaggagaagaagtcgcctgc
ttccttcacgaagcgcaggcaggattccagctgccgccttcatccgaaacaccgatgatc
atgatcggacctggtacaggaatcgctccatttagaggatttgttcaggcaagagaagtg
tggcagaaggaaggcaagcgactaggtgaagctcacctgtattttggctgccgtcaccct
catgaagatgatctgtattttgaggaaatgcagcttgcagcgcaaaaaggagttgttcac
atccgccgggcttattctcgtcacaaagaccaaaaagtatatgtccagcatttgttaaaa
gaagacggcggtatgctcatcaaattactcgatgaaggtgcgtacctttacgtgtgcgga
gacggaaaagtcatggcaccagacgtagagtctacattgatcgacctctatcaacacgag
aaacaatgctcgaaggaagatgctgaaaattggctaacaaccctagcaaataataataga
tatgtaaaagatgtatggagctaa

DBGET integrated database retrieval system