KEGG   Bacillus pumilus: BPUM_1723Help
Entry
BPUM_1723         CDS       T00599                                 

Gene name
thrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpu  Bacillus pumilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bpu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bpu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1771472..1772575)
Genome map
AA seq 367 aa AA seqDB search
MNQLICHHCGKKYEMTPTLWKCDCDGVLNLVKDTPKIDVAAWNHYPNSLWRYVETMPFSK
GSNTWETVTMGEGQTPLIVLDPHEPNTYVKVDYMMPTLSFKDRGAAVLMTHAKELGVSKV
IADSSGNAGTAIAAYAARCGIACDIYLSDDTSPKKVAQIKAHGATIKEIHGTREDIAAAA
QKAVDNEKVFYASHVYNPYFFEGTKTYAYEIYEQLNGAPDTLIIPVGNGTLLLGAYDGFK
ELFENGLILKIPKIIAIQAKNCAPLVKAYQNEEKSASPVTNKGTLAEGIAIAAPARSKQI
LEAVQDTNGTFIDIEEDEILNARSKLSEKGFYVEVTSAVNLAGYMKYQKKPEETIVIPLC
GAGIKSK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattaatttgtcaccattgtgggaaaaaatatgagatgacaccaactctatgg
aaatgtgattgtgatggcgtattaaatctagtgaaagataccccgaaaatagacgtcgca
gcatggaatcactatccaaactccttatggcgttatgttgaaaccatgccattttcaaaa
ggttctaacacttgggaaacggtcacaatgggggaggggcaaacccctttaatcgtactt
gatcctcatgagccaaacacttatgtaaaagttgattatatgatgccgacattatccttt
aaagaccgaggagccgctgtattgatgacacatgcaaaagaattaggggtatcaaaggtg
attgctgatagtagtgggaatgcaggaacggcgattgcagcttatgcagcacgttgcggt
atcgcctgtgacatctatctaagcgatgacacttcacccaaaaaagtcgctcaaatcaaa
gcccatggcgcaacgattaaagaaattcacgggacgcgagaggacattgcagctgcagca
caaaaggcagtagacaatgaaaaggttttttatgcaagtcatgtctataacccttatttt
tttgaaggcactaaaacatacgcctatgaaatctatgaacaactaaatggagcacctgat
actttaatcattccggttggcaacggtactctcctcctaggggcgtatgatggttttaaa
gagttatttgaaaatggtttgattcttaaaataccgaaaatcattgccatacaagcgaaa
aactgtgcacctcttgtgaaagcttatcaaaatgaagagaaatcagcatcgcctgtcaca
aataaagggaccttagcagaagggatagccattgctgccccggcgcgctctaaacaaatt
ttagaagctgtacaagataccaatggtacatttatagatattgaagaagatgagatattg
aatgctcgctctaaattaagtgagaaaggattttatgtcgaagtgacctcagcagtcaat
ttggctggctacatgaaatatcaaaagaaaccagaagaaaccattgtcatacctctttgt
ggtgcagggataaaatcaaaataa

DBGET integrated database retrieval system