KEGG   Bacillus pumilus SAFR-032: BPUM_1779Help
Entry
BPUM_1779         CDS       T00599                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00010  Glycolysis / Gluconeogenesis
bpu00620  Pyruvate metabolism
bpu00640  Propanoate metabolism
bpu00680  Methane metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_1779
   00620 Pyruvate metabolism
    BPUM_1779
   00640 Propanoate metabolism
    BPUM_1779
  Energy metabolism
   00680 Methane metabolism
    BPUM_1779
Enzymes [BR:bpu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BPUM_1779
Lipid biosynthesis proteins [BR:bpu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BPUM_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABV62451
UniProt: A8FDY4
Position
complement(1825105..1827039)
Genome map
AA seq 644 aa AA seqDB search
MMNLKPVWKPEEQMIKQTRLYKWMHSLDFSTYDAFYKASIERTDWFWREAEKAVGIKWKV
PYEAALGQDSFMWPKWYKGGQLNITETAVDKWAENEEAQHQPAVIWKNEMGEERRWTFLD
LQEKVNRLAAGFLKNGLQKGDVAVIYMPMLPETVAVMLAFAKIGVIFSPVFSGYGSEPLA
VRIRASGAAIVVTGSGMTRRGKKINMRECAAEAIDKTSTVKTVIVHTFSETEYEGDIRLN
DLLTEDPICETTYLSNEEPLMILYTSGTTGTPKGAVHTHAGFPVKAAFDAGLCMDVAKGD
RLFWLTDMGWMMGPFLVFGGLINGAAIVLYDGAPDYPDEQHLWSFIHEQKVTHFGLSPTF
VRSAMQQDLASIKLPHVKAIISTGEPWNEAPWQWLFDKIGHKHIPILNYSGGTEVSGGIV
GSTLLRPIKPVLFNAAILGMAADVYNEEAESVINEVGELVVKKPWVGMTCGFWKDPERYE
DTYFKRFDGVWTHGDWVVQSDDGTFHITGRSDDVINTAGKRVGPAEIESILVGHPAVHEA
AVIGVKDEVKGEALVCFIVTGPQSCDESKLIQELKTHVGSYAGKALTPKDIHLISALPKT
RNGKIVRRLLKGAYEQQPSPDLSSLDNPHVYESICEYLNRKQNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacctgaaaccagtatggaaaccggaagagcagatgatcaaacagacacgtctt
tacaaatggatgcactcacttgatttttctacttatgatgcattctacaaagctagtatc
gagcgtacggattggttttggagagaagctgaaaaggcggtcggtatcaagtggaaagtt
ccatatgaagctgcattaggtcaagattcattcatgtggccgaagtggtataaaggcggg
caactcaacataaccgaaacggccgtggacaagtgggcagagaacgaagaagcgcagcat
cagccagccgtgatttggaaaaacgagatgggagaagagaggagatggacgtttctcgat
cttcaggaaaaagtaaatcgccttgctgctggctttttgaagaatgggcttcaaaaagga
gatgtggccgtcatttatatgccgatgcttcctgaaacggttgctgtcatgctagccttt
gcaaaaattggtgttatctttagtcctgtcttctccggttatggaagcgagcctcttgcg
gtgcgtattcgtgcgtcaggtgcagctattgtcgtcacaggctcaggcatgacgcgccgc
ggaaagaagatcaatatgcgagaatgtgcggcagaagccatagacaaaacctcaaccgtc
aaaaccgtcatcgtacacaccttctctgaaactgaatatgaaggggatatcaggcttaat
gatttattaacagaagacccgatatgtgaaacgacctatctctcaaatgaagagcctctc
atgatcttatacacttctggaacaacgggcacgccaaaaggagctgtccatacacacgca
ggctttcctgtaaaagcagcttttgatgctggtctttgtatggacgttgcaaaaggagac
cgcttgttttggctcacagacatgggctggatgatggggccatttctcgtctttggcggc
ttgatcaatggagctgcgattgttttatatgacggcgcacccgattatccagatgaacag
cacctctggtcatttattcacgagcaaaaggtcacccactttgggctttcacctacgttt
gttcgatccgcgatgcagcaagatcttgcaagtataaaactaccccatgtcaaagccatc
atatctacaggtgagccgtggaatgaagcaccatggcaatggctttttgacaaaattggt
cacaagcatattccaattctaaactattcaggaggaacagaagtctctggtggaattgta
ggaagtacgctgcttcgcccaattaagccagtcctctttaatgcggcaatcttaggaatg
gcagctgatgtatataatgaagaagctgagagcgtcataaatgaagtaggagaactcgtt
gtgaaaaagccttgggtcggcatgacatgcgggttttggaaagatcctgaacgttatgaa
gatacgtatttcaaacgatttgatggggtgtggacgcatggtgattgggtggtgcaatca
gatgatggcacgtttcatatcactggcagatcagatgatgtcattaatacagcaggaaaa
cgtgtcggtccagcagaaatagaatccattcttgtcgggcatccagcagtacacgaggca
gcagtgattggggtcaaggatgaggtgaaaggggaggcactcgtgtgcttcatcgtgacc
ggcccgcagtcttgtgacgaatcaaaattgattcaagaactcaaaactcatgttggttca
tatgcgggaaaagcgctcacgccaaaggacattcatctgatttcagctttaccgaaaaca
agaaacggaaaaatcgtccggcgcttattaaaaggagcttatgaacagcaaccttcacca
gatctttcttctttagacaatcctcatgtatacgaaagtatttgtgagtatttgaaccgg
aaacagaatcaatag

DBGET integrated database retrieval system