KEGG   Bacillus pumilus SAFR-032: BPUM_1801Help
Entry
BPUM_1801         CDS       T00599                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_1801
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPUM_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1848510..1849331)
Genome map
AA seq 273 aa AA seqDB search
MSKGLSGKTIAICGTRKTEEMRTLVEKQGGQAVIRSLQGTVFLAKEELKPGIETFVKKGA
DWVVLTTGIGTDTLIESAEELDLGEEFMHILSNAQIASRGYKTYAALKKRGIQPDVSDED
GTVRDLIAKLEGKEFQGKRVMVQLHGENAPALIQFLHEKGADVLPLLPYQHTPPEPKAAE
TLLQEMKDGNVHAVCFTTAVQVHAFFTLAAKWGRKEELQALFEQHVLAVAVGKVTAEALK
EEGIDRILTPSLERMGAMIMELSQYMKKQSSHS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaggcttatctggaaaaacgattgccatttgtggaacgagaaaaacagaagaa
atgcgtacacttgtcgaaaagcaagggggacaagctgttattcgttctcttcaaggaacc
gtatttttagccaaagaggagttaaagccaggcattgaaacttttgtgaaaaaaggtgcc
gattgggtggttttaaccacaggtatcggaactgatacattaattgagagtgcagaagag
cttgatttaggagaagaatttatgcatattctatcaaatgcacaaattgcttcaagagga
tacaaaacttatgctgcactcaaaaaacgcggaattcagccagacgtgtctgatgaagat
gggacagtacgtgatctgatcgcaaagcttgaaggcaaagagtttcaaggcaaacgtgtc
atggtgcagctgcacggggaaaatgctccggccctcatccagtttttacatgaaaaaggg
gcagatgtattgccacttttaccttatcagcacacaccacctgaaccaaaagccgcagaa
acattgcttcaagaaatgaaagacggaaatgtccacgccgtctgttttacaaccgctgtt
caggtacacgcctttttcacgttagcagcaaaatggggaagaaaagaagaacttcaagcg
ctatttgagcagcacgtactggcagtagctgttggaaaagtcacagctgaagctttaaaa
gaagagggcattgacaggattcttaccccgtcacttgagagaatgggcgcaatgattatg
gaattatctcaatatatgaaaaaacaatcctcacactcatag

DBGET integrated database retrieval system