KEGG   Bacillus pumilus: BPUM_1808Help
Entry
BPUM_1808         CDS       T00599                                 

Gene name
pme
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bpu  Bacillus pumilus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpu00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1860392..1861372)
Genome map
AA seq 326 aa AA seqDB search
MKYGKVWLVIALSLLLLNSASLQAAGHQNQTNRVLVVDQKGNGSFRTVQSAIDAIPANNQ
QRVTIYIKNGVYKEKILLPQNKPYVSLIGEDQDNTILTYNDTNASTGSTTNSSSTMIRAN
DFYAENITFQNTAGRYAGQAVALYVSGDRATFKQIRVLGYQDTLYATGTGRQYYENCYIE
GTVDFIFGSATAVFKRAEIKSLGNGYITAASTTESQKYGYVLIDSTLQKGTAAAQSVYLG
RPWRPHSAVTFLNTKMDHHIKAEGWHNWDNRDNERTARYKEYGSTGAGSNLTNRVKWSSI
LTKNEASQITVQAVLGGADGWNPEKR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatggaaaggtatggcttgtgatcgccttgtctttattactattgaactcagct
tcacttcaagcagccggacatcagaatcaaacaaatcgcgtccttgtggttgatcaaaag
ggaaatggctcgtttcgaaccgttcagtctgccattgatgcgattccagcaaataatcaa
cagcgcgtcacgatctatattaaaaatggtgtgtataaagagaaaatcctgcttccgcaa
aataaaccttacgtgtccttgatcggggaagaccaagacaatacgattctgacctataat
gatacaaatgcaagtactggcagcacaacaaatagttcaagcacaatgattcgtgcgaac
gacttttatgcggaaaatattacctttcaaaatacggcgggcagatatgctggtcaggcg
gttgcactgtacgtttctggtgaccgggctacgttcaaacaaatacgtgtcttaggatat
caagatacactttatgcaacgggtacaggccggcaatattatgaaaactgctatattgaa
ggtacggtcgattttatttttggatcagctacagccgtgtttaaaagagctgaaataaaa
agtcttggaaatgggtatattactgcagcatccacaacagaatctcaaaaatatggctat
gtattaattgattctacgctgcaaaaggggacggctgctgctcaatcggtttatttagga
cgtccgtggaggcctcattctgctgtgacattcctcaatacaaaaatggatcatcatata
aaggcagagggctggcataactgggataaccgcgataacgaaagaacagcaagatataaa
gaatacggatcgacaggggcaggaagcaatttgacaaaccgcgtaaaatggtccagcatt
ttaacgaaaaacgaagcaagtcaaatcaccgtgcaagctgttcttggcggagccgatggc
tggaatccagaaaaaaggtaa

DBGET integrated database retrieval system