KEGG   Bacillus pumilus SAFR-032: BPUM_1861Help
Entry
BPUM_1861         CDS       T00599                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPUM_1861 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPUM_1861 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BPUM_1861 (odhB)
Enzymes [BR:bpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPUM_1861 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1924607..1925863)
Genome map
AA seq 418 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEVIGTIAAGEAGGSESAAPAPEQESAPAPKDEPAAAQKEEAVKEEPKSGNG
RTIASPAARKLAREKGLDLSEIPTVDPLGRVRKQDVASYQKNEAPASAPKAAPKANAAVQ
NEQAGKPVERERMSRRRQTIAKRLVEVQQTAAMLTTFNEVDMTAVMDLRKRRKDAFLEQN
DVKLGFMSFFTKAVVAALKKYPLLNAEIQGDELVLKKFYDIGIAVAANEGLVVPVVRDAD
RLSFAGIEKEIGHLAKKARDNKLSLNELQGGSFTITNGGTFGSLLSTPILNSPQVGILGM
HKIQLRPVAIDEERFENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaagtacctgaattagcggaatcgatctcggaaggaacgatagctcaa
tggctcaagcagccgggcgattatgtggaacagggagaatacctgttagagcttgaaaca
gataaagtcaatgtcgaactgacagccgaagaatctggtgtactcaaagaagtgctgaaa
gattctggtgacactgtacaagttggagaagtcatcggaacaattgcagcgggtgaagct
ggcggaagcgagtccgcagctccagcacctgagcaagagtctgcaccagctccgaaagat
gaaccggctgctgctcaaaaagaagaagcagtgaaagaagagccgaaatctggtaatggc
agaaccatcgcttctcctgcagctagaaaactagcgagagagaaggggctagacttatct
gaaattccaaccgtagatccgctgggcagggtacgaaagcaggatgttgcttcttatcaa
aagaatgaagcacctgcaagtgcaccaaaagccgcgccaaaagcaaatgctgcggtgcaa
aatgaacaagcaggaaagccagttgaacgtgagagaatgtcgcgccggagacaaacgatt
gccaaacgtttagttgaggttcagcaaacggctgcaatgctgacgacatttaatgaagta
gatatgacagctgtgatggacttaagaaagcgccgtaaagatgccttccttgaacaaaat
gatgtaaagcttggtttcatgtccttcttcacaaaagcagttgtagcagcactgaagaaa
tatccgctgcttaacgcagaaattcaaggtgatgagcttgtcttgaagaaattctatgac
atcggcatcgctgttgctgctaacgaaggacttgtcgtaccggttgtccgtgatgcagac
agattgtcgtttgcagggattgaaaaggaaattggtcatcttgcgaaaaaagcacgagat
aacaaattgtctctaaatgagctacaaggtggatcattcacgatcacaaacggcggaaca
ttcggttcactgctttcaacaccaattttaaacagccctcaagttggaattttagggatg
cacaaaattcagcttcgacctgtggcaattgatgaagaacgttttgagaaccgtccgatg
atgtatttagctctttcttacgaccaccggattgtcgatggaaaagaagcagttggattc
cttgtcacgattaaaaacttgcttgaagatccagagcagctattgcttgaaggataa

DBGET integrated database retrieval system