KEGG   Bacillus pumilus SAFR-032: BPUM_1995Help
Entry
BPUM_1995         CDS       T00599                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00260  Glycine, serine and threonine metabolism
bpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01130  Biosynthesis of antibiotics
bpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_1995
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPUM_1995
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPUM_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABV62665
UniProt: A8FEJ8
Position
complement(2044373..2045572)
Genome map
AA seq 399 aa AA seqDB search
MYAYPNELGRYGEFGGKFVPETLMQPLKEIEQAFNELKEDPAFEQEYLSLLHNYSGRPTA
LTYADQLSAYLGGAKIYLKREDLNHTGAHKINNALGQALLAKKMGKSNIIAETGAGQHGV
AAATVAAKFGLSCTVFMGKEDVERQSLNVFRMKLLGAEVIPVTSGNGTLKDATNEAIRYW
VQHCSDHFYMIGSVVGPHPYPQIVSEFQRMIGDEAKEQMLKKEGRLPHKVIACVGGGSNA
IGMYRAFLDDEVDLIGVEAAGKGIDTPLHAATITKGTKGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHASGRVQYVSATDQEALDALKLLTEKEGILPAIESAHALAKA
FEMSRTMSEDEIILVCLSGRGDKDVHTLMNVLESEGKTK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatccaaatgagcttggcaggtatggagaatttggagggaaatttgttcct
gagacactcatgcagccactcaaagaaatagaacaagcatttaacgaattaaaagaagac
cccgcttttgagcaagaatatctttctctattgcacaactattcaggcagaccgactgca
ctgacatatgccgatcaattatctgcatacctcggcggcgcaaaaatctatttaaaaaga
gaagatttaaaccatacaggtgctcataaaatcaacaatgcacttggtcaggccctgctt
gcaaaaaaaatgggcaaatcaaacatcatcgcagaaacaggcgctggacagcacggagta
gcagctgcaacggtggctgcaaagtttggattatcgtgcacggtatttatgggaaaagaa
gatgtggagagacaatcactcaatgtattccgaatgaagctccttggcgctgaagttata
cctgtcacaagtggaaacggcacattaaaagatgcgacaaacgaagcgattcgttactgg
gttcagcactgtagtgatcatttctatatgataggttcagttgtaggacctcacccgtat
ccccaaatcgtcagtgagttccagcggatgattggtgatgaagcaaaagagcagatgctt
aaaaaagaaggcaggctcccacataaagtcattgcttgtgtcggtggcggaagtaatgcg
attggaatgtaccgagcgtttttggatgatgaggttgatttgattggtgtagaagcggct
ggaaaaggaattgatacaccgcttcatgcagcaaccattacgaaggggacaaaaggggtc
attcatggatctttgacctatttaatccaagacgaattcggccagattattgagccctat
tccatttcagctggtttagattatcccgggatcggaccagagcacgcctatttacatgcg
agtggacgtgttcaatatgtgagtgctacagatcaagaagccctggatgcactaaagctg
ctgacagaaaaggaaggaattctaccagcgattgaatcagcacacgctttagccaaggca
tttgagatgagcaggacgatgagtgaagatgaaatcatccttgtctgcctctcaggaaga
ggagataaggatgtgcatacattaatgaatgtgcttgaaagtgagggcaaaaccaaatga

DBGET integrated database retrieval system