KEGG   Bacillus pumilus SAFR-032: BPUM_2215Help
Entry
BPUM_2215         CDS       T00599                                 

Definition
(GenBank) glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPUM_2215
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_2215
   00052 Galactose metabolism
    BPUM_2215
   00500 Starch and sucrose metabolism
    BPUM_2215
   00520 Amino sugar and nucleotide sugar metabolism
    BPUM_2215
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPUM_2215
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BPUM_2215
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BPUM_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2235119..2236072)
Genome map
AA seq 317 aa AA seqDB search
MIGDWFVGVDLGGTTIKLAFINLYGEIQHKWEIPTDKSGQTITVDIAKSIDHKLVEISMP
KSALIGIGMGAPGPVDKVSGIVYKTTNLGWTNYPLKDHLEAETGLPSVIENDANIAALGE
MWKGAGDGAKNILMVTLGTGVGGGIIVNGEVVQGETGAGGEIGHICAVPFQGAPCNCGRT
GCIETIASATGIVRLAKDQLVTEQHTSSLGTVTSLTAKDVFQAAESGDDLAMRVVEEVTT
HLGLVLANLASALNPTKIVIGGGVSKAGELLRSKVENVVKYHAFPPCADDVEVVIASLGN
DAGVIGGAWMAKNKWLS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgataggggattggtttgtaggggttgatcttggcggtacgacaattaagcttgcgttc
attaatctatatggtgaaattcagcataagtgggagattcctacggataaatcagggcag
acgatcacagtcgatattgccaaatcaatagaccacaaattggtcgaaatcagtatgccc
aaatcagcactgattgggattggaatgggtgcacctgggcctgtagataaagtatctggg
attgtctataaaacaacgaatctaggctggacaaactatccactcaaagatcacctagag
gcagagacaggacttccatctgtcatcgaaaatgatgcgaatattgctgcactcggtgaa
atgtggaagggtgcaggcgatggggcaaaaaatatcctgatggtcacacttggtacaggt
gttggcggcggcattattgtaaatggtgaagttgttcaaggtgaaacaggggctggcgga
gaaattggccatatttgtgccgttccattccaaggagcaccgtgtaactgcggaagaacg
ggctgtattgaaacgattgcatctgcgactggcatcgtccggcttgcaaaggatcaatta
gtcacagagcagcatacctcttcacttggtacagtcacgtcactgactgcaaaggatgtg
tttcaggcagctgaaagtggagatgaccttgccatgcgtgtcgtagaagaagtgacgact
catcttggtctagtcttagcgaatcttgccagtgcgttaaacccaacaaaaattgtgatt
ggcggcggtgtttcaaaagcaggtgagcttcttcgtagtaaagtagagaacgttgttaaa
tatcacgcatttccgccttgcgctgatgatgtcgaagttgtgattgcctcacttggtaac
gatgcaggtgtcattggcggtgcatggatggcaaaaaacaaatggttgtcttaa

DBGET integrated database retrieval system