KEGG   Bacillus pumilus SAFR-032: BPUM_2355Help
Entry
BPUM_2355         CDS       T00599                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00625  Chloroalkane and chloroalkene degradation
bpu00680  Methane metabolism
bpu01100  Metabolic pathways
bpu01120  Microbial metabolism in diverse environments
bpu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BPUM_2355
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPUM_2355
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BPUM_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C FAD_binding_2 FAD_binding_3 PALP Pyr_redox_3 FAD_oxidored 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABV63021
UniProt: A8FFK4
Position
complement(2366343..2367557)
Genome map
AA seq 404 aa AA seqDB search
MSGNKGVVYKGAGNVAVEDIGYPDLILRDGPGVPKANVGRKCEHGVILKVVTTNICGSDQ
HMVRGRTTAPAGLVLGHEITGEVVEVGRDVEFIQKGDLVSVPFNIACGRCVMCKEQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLKFPDKDQAMEKILDLTMLSDI
FPTGFHGAYTAGVKPGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEQRLEQARSFG
CETINLRKHDRIGEQITNILGEPEVDCAVDCVGFEASGHGDQGEAPATVLNTIMDITKVG
GKLGIPGLYVTEDPGAVDADAKVGSLKVRIGLGWAKAHTFVTGQTPVMQYHRSLMKSILS
GRAQIAKAVNATVINLDQAPQGYSDFDSGVAKKFVIDPHGMISR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaacaaaggtgtcgtttataaaggagcaggaaatgtagcagttgaggatatt
ggataccctgatttgattttaagagatggcccgggtgtaccgaaagccaatgtggggcgc
aaatgtgagcatggcgtcattttaaaagtagtgacgacgaatatttgcggaagtgaccag
cacatggtgagaggtcgtacgactgcgccggcaggactcgtccttggtcatgaaattaca
ggtgaagtcgttgaggtaggacgagatgtggagtttattcaaaaaggagaccttgtgtct
gttccatttaatattgcttgcggacgatgcgtcatgtgtaaggaacaaaaaacccatgtg
tgcttaaatgtaaacccggaccgtccaggctctgcctatggatatgtcgatatgggcgga
tgggttggcggccaatccgagtacgtcatggtaccatatgcagatttccagttgctgaaa
ttcccagacaaagatcaagcgatggaaaaaatacttgatctgacaatgctttccgatatt
ttcccgacaggttttcacggtgcgtatacggctggagtaaaacctggttcaaccgtatat
attgccggtgcagggccagtaggtcttgccgcagcgcattccgctcagctccttggcgct
tctacagtcattgtaggagatttgaatgaacaaaggctggagcaggccagaagctttggc
tgtgagacgatcaatttacgaaaacatgatcgaatcggcgaacaaatcaccaacatctta
ggagagccagaagtagactgtgccgtcgattgtgttggctttgaagcttcaggtcatgga
gatcaaggagaagcacctgcaaccgttttaaatacaattatggatattaccaaagttggc
ggtaaactcggaatcccaggactttacgtcacagaagaccctggtgcagtggatgctgat
gcaaaagttggatcactgaaagtgcgaattggactcggctgggcaaaagcccataccttt
gtgacaggtcaaacccctgtcatgcaatatcaccgcagtctaatgaaatctattttaagc
ggacgagcacaaatcgccaaagcagtgaatgcaaccgtcattaatcttgatcaagcccct
caaggatacagtgactttgattcaggtgtagcgaagaaatttgtcattgacccgcatggg
atgatttctcgataa

DBGET integrated database retrieval system