KEGG   Bacillus pumilus SAFR-032: BPUM_2374Help
Entry
BPUM_2374         CDS       T00599                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00071  Fatty acid degradation
bpu00072  Synthesis and degradation of ketone bodies
bpu00280  Valine, leucine and isoleucine degradation
bpu00310  Lysine degradation
bpu00362  Benzoate degradation
bpu00380  Tryptophan metabolism
bpu00620  Pyruvate metabolism
bpu00630  Glyoxylate and dicarboxylate metabolism
bpu00640  Propanoate metabolism
bpu00650  Butanoate metabolism
bpu00900  Terpenoid backbone biosynthesis
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
bpu01212  Fatty acid metabolism
bpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPUM_2374
   00630 Glyoxylate and dicarboxylate metabolism
    BPUM_2374
   00640 Propanoate metabolism
    BPUM_2374
   00650 Butanoate metabolism
    BPUM_2374
  Lipid metabolism
   00071 Fatty acid degradation
    BPUM_2374
   00072 Synthesis and degradation of ketone bodies
    BPUM_2374
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPUM_2374
   00310 Lysine degradation
    BPUM_2374
   00380 Tryptophan metabolism
    BPUM_2374
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPUM_2374
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPUM_2374
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPUM_2374
Enzymes [BR:bpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPUM_2374
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPUM_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABV63040
UniProt: A8FFM3
Position
complement(2384188..2385276)
Genome map
AA seq 362 aa AA seqDB search
MQAVIVQAKRTPFGDKNGMLKNYRPEQLAAPLIRYLSKGMTPDDIILGNVVGGGGNMARL
SSLEAGLSLGVPGMTVDRQCASGLEAIRTACVMVKSGEGSMYIAGGTESISRSPMKEKAR
FSPEWIGDPAMGEAAELTASRFSVTRKEQDDYAQLSWERSIDAIKRGTYSEEIVTIDGLS
IDEAAVKIRPMAKLIQRAKPVFSPGKGSVTAANSCKEADGAAAVVVMERSQAEANGFQPM
LRYAGSAVTAMHPNFPAAAPIDAMKKLLDQEKIKAEDVALFEINEAFALKIALIARTLDI
PYDRINKRGGALCLGHPYSASGAAMMVRLFYEARTLPNGSYVMAAIGSGGGVGLAVLCQV
LS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtaattgtacaagcaaaacggacacccttcggtgataaaaatgggatgctg
aaaaattatcgtccagagcaattagccgcgcctcttattcggtatttgtctaaagggatg
acgccggacgatattatattaggaaatgttgtaggaggcggcgggaatatggcccgtctg
tcctcattagaagcagggctttctttaggggtacctggtatgacagttgataggcagtgt
gcttcaggtctagaagccatccgaacagcttgcgtcatggttaaatcaggggaaggctca
atgtatatcgctggcgggactgaaagcatttcgagatcaccaatgaaagaaaaagcccgc
ttttcaccggaatggataggagatccggctatgggagaagcagcagagctgacggcttct
agattttctgtgacaaggaaagaacaagatgactatgcgcaattaagctgggaaagaagt
atagacgcaatcaaacgtggtacatattctgaagaaatcgttacgattgacggactgagc
atagatgaagcggccgtgaaaataagacctatggcaaagctgattcagcgggcaaagcct
gtattttcacccggaaaaggatctgtcactgccgccaatagctgtaaagaagcagatggt
gcagccgcagttgttgtgatggaaagatcgcaggcagaggcaaatgggtttcagccaatg
ctgcgatatgccggaagtgctgtgacggcgatgcatcccaattttccagctgctgcgccg
attgatgcgatgaagaaacttctagatcaagagaaaatcaaggcagaggatgttgcactg
tttgaaatcaatgaagcctttgctctgaaaatagcgctgattgctcggacgctagatatt
ccttatgacaggatcaataagagaggtggtgcactttgtcttggtcatccatatagcgca
tcaggagctgcgatgatggtgagactgttttacgaagcgcgcaccttaccgaatggaagc
tatgtcatggccgcaattgggagtggtggcggcgtcggtttagccgtattatgtcaagtt
ctgtcatga

DBGET integrated database retrieval system