KEGG   Bacillus pumilus SAFR-032: BPUM_2389Help
Entry
BPUM_2389         CDS       T00599                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPUM_2389 (recD)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BPUM_2389 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2396675..2399059)
Genome map
AA seq 794 aa AA seqDB search
MQEHPDQMKLEDEPFLKGTVQAVIFHNESNLYSVLKVKVIETSENLEEKTASVTGYFPAL
HEEETYTFYGKVTSHPKFGEQFQATHFQKEVPTTKQGIIHYLSSDLFEGIGKKTAEEIVG
KLGSETLHKIMRDPAVLYDVPRLSKKKADKLAAALQEHQGLEQIMISLNQYGFGPQLSMK
IYQVYESETLQKIEENPYQLVKDVEGIGFIKADELGARTGISGSDPERIRAALLYTVETA
SLQDGHTYIQTKDLIVETRKLLNQTGNEYKVTEMDVADQIIALGEGKEMIIEDERCYHPS
LFYAEQSVAKRIQKIVSQTEYADQFPESEFLLALGELEERLGVQYAPTQKEAIQKALMSP
MLLLTGGPGTGKTTVIKGIVELYSDLHGVSLDPSDYKKDESFPFVLAAPTGRAAKRMTES
TGLPAVTIHRLLGWNGSEGFSHDDEQPIEGKLVIIDESSMLDIWLANHLFKAIPDHIQVI
MVGDEHQLPSVGPGQVLRDLLASQAVPAVTLTDIYRQADGSSIVELAHDMKNGVLPKDIT
ARSKDRSFIKCSADQMKEVIEKVVSNAAQKGYSAKDIQVLAPMYKGKAGINELNKMLQHI
LNPKKPKGREIPFGDVVYRTGDKVLQLVNQPENNIFNGDIGEIVSIFYAKENTEKEDMAV
ISFDGNEITFTKKDFHQFTHAYCCSIHKSQGSEFPIVVLPVVRSYYRMLRRNLLYTAITR
SKKFLILCGEESALEWGVKNNEDSLRQTSLTMRLVQTEEIMDAELAALQKELPFSVHDAN
IGMEGITPFDFMHE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaacatccagatcaaatgaagcttgaggacgaaccgtttttaaaggggacagtt
caagccgttattttccataatgaaagtaatttatactcggtgttaaaggtgaaagtcatt
gaaacatcggaaaacttagaggagaaaacagcatctgtcacaggctacttcccagcactt
catgaggaggaaacttacaccttctatggcaaagtcacgagccatccgaagtttggtgaa
cagtttcaggcgactcattttcaaaaggaagtaccgacaacaaaacaaggaataatccat
tatctttcaagtgatttatttgaggggataggcaaaaagacagcggaagaaattgtagga
aagcttggcagtgagacgcttcataaaattatgcgtgacccagcggttttgtatgacgtt
ccgcgcttatcaaaaaagaaggctgataagctggccgcagcgctccaggagcatcaagga
ttggaacaaatcatgatcagcttgaatcaatacggctttggtccgcagctcagcatgaag
atttatcaagtgtacgaaagtgagacgctgcagaagattgaagaaaacccgtatcagctc
gtcaaggatgttgaagggatcggatttattaaggcagatgaacttggcgctagaaccggc
atctcaggaagtgacccagagcgaatccgtgcagccttgctttatacagtggagacagcc
agtcttcaggacggtcatacgtacatacaaacaaaggatttgatcgtcgaaacccgaaaa
ctgctcaatcaaacaggcaatgagtacaaagtgacggaaatggacgtcgccgatcagatc
attgcacttggcgaagggaaagagatgatcattgaagatgagcggtgctatcatccgtcc
ttattttatgccgagcaaagtgtcgcgaaacgtatacaaaaaatcgtctcccaaacggaa
tatgcagatcaatttcctgaatcagaattccttctagcccttggtgagctagaggaacgg
ctgggcgtccaatatgcgccgacacaaaaggaagcgattcaaaaggcactcatgtcccca
atgctgcttttaacaggcggacctgggactgggaagacaacagtcattaaagggattgtt
gagctttacagcgatcttcatggtgtatcactggacccaagtgattataaaaaagatgaa
tccttcccatttgtgcttgcggcaccaactgggcgagcagctaaacggatgacagaatca
acagggcttccagctgtgacgattcatcggctgcttggttggaacggatcagagggattt
tctcatgatgatgaacagccgattgaaggaaagcttgtcatcattgatgaatcaagtatg
ctagatatttggcttgcgaatcatttgtttaaagccattcctgaccatatacaagtgatc
atggtgggggatgaacatcaacttccgtctgtcggaccaggccaagtgttaagagacttg
cttgcatcacaagccgtgccagcggttaccctaaccgatatttaccggcaggcagacggc
tccagcattgttgaacttgcacatgatatgaaaaatggtgtcctgccaaaggatattacc
gcacgttcaaaggatcgatctttcatcaaatgctcagcagatcaaatgaaagaagtgatt
gagaaagtcgtcagcaatgctgctcaaaaaggctattcagctaaagatattcaagtgctt
gcgcccatgtacaaaggaaaagcaggcattaatgagctcaataaaatgctgcagcacatt
ttgaatcctaaaaaaccaaaaggccgagaaattccttttggtgatgtggtgtaccggact
ggtgataaagtgcttcagcttgtgaatcagccagagaacaatatttttaacggtgatatt
ggcgaaattgtctcaattttttatgcgaaagaaaacacagaaaaagaagatatggctgtg
atctcctttgatgggaatgaaatcacttttactaaaaaggattttcatcaatttacacat
gcctattgttgctctatccacaaatcacaaggcagtgaattccccatcgttgtactgcca
gtcgtgagaagttactacagaatgcttcggcgaaatttgctgtacacagccattacacga
agtaaaaagtttttaatcctgtgcggcgaggaatcagcactcgagtggggcgtgaaaaac
aatgaggattccctcagacaaacgtccttaacgatgcggctcgtgcaaaccgaagagatt
atggatgcggagcttgcagcacttcaaaaagaactgccgtttagcgtgcatgatgcaaat
atcggtatggagggaatcactccatttgattttatgcatgaataa

DBGET integrated database retrieval system