KEGG   Bacillus pumilus SAFR-032: BPUM_2416Help
Entry
BPUM_2416         CDS       T00599                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPUM_2416 (ruvA)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPUM_2416 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2426725..2427330)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVCPQYVVIENGGVGYQVYSPNPFIYQINKQETIYTYHYIKEDAFSLYGF
QTREEKALFTKLLNVTGIGPKGALAILASGDPGAVISAIEREDEAFLIKFPGVGKKTARQ
IILDLKGKLADVVPEMIGNLFNHEDHIQVETQQTALDEALEALSVLGYGDREIKKVYPLL
KEEKNLTTDQYVKKALQKMLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatagagtttgtaaaagggaccattgattatgtgtgcccgcaatatgttgtcatagaa
aacggcggagtgggatatcaagtctatagcccaaacccgtttatctatcaaatcaataaa
caagaaacgatttatacgtatcattacataaaggaagacgctttctcgttatatggattt
caaacacgagaagaaaaagcgctgttcacaaaactgttaaatgtcacagggattgggccg
aagggggctctagcgattcttgcttccggtgatcctggcgctgtgatctcagcgatagaa
cgtgaagatgaagcgttcctgattaagttccctggcgttggcaaaaagacagctcgccaa
atcattctcgatctaaaaggaaagctagcggatgttgttcctgaaatgattggcaatcta
tttaatcacgaggaccatattcaggtcgaaacgcagcaaacggcattagacgaagcgctt
gaagccttaagtgttcttggatacggtgatcgcgaaattaaaaaggtatatccattgtta
aaagaagaaaagaatctcacaaccgatcaatatgtgaaaaaagctttacaaaaaatgttg
aaatag

DBGET integrated database retrieval system