KEGG   Bacillus pumilus SAFR-032: BPUM_2454Help
Entry
BPUM_2454         CDS       T00599                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00860  Porphyrin and chlorophyll metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_2454
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BPUM_2454
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPUM_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM HMA
Motif
Other DBs
NCBI-ProteinID: ABV63117
UniProt: A8FFV0
Position
complement(2463123..2464094)
Genome map
AA seq 323 aa AA seqDB search
MMKFNRHRRLRTSAGMRELVRETFLRPSDFIYPIFFVEGENVRKEVSSMPGVYHISVDLV
KEEVKELVDLGIKSIIVFGVPDHKDHVGSEAYHDHGIVQRATLEIKKHFPELVVIADTCL
CQYTDHGHCGIVEDGEILNDESLQLLAKTAVSQASAGADIIAPSNMMDGFVVAIREALDE
AGFIHVPVMSYAVKYASAFYGPFRDAAHSTPQFGDRKTYQMDPANRLEALREAQSDVEEG
ADFLIVKPSLSYLDIMRDVKNEFTLPVVAYNVSGEYAMVKAAAQNGWISEKELVLEMLTS
MKRAGAELIITYHAKDAAKWLSE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttaacagacaccgcagactgcggacaagcgcaggaatgagagaattagtc
agagaaacctttttaagaccatctgatttcatttatccgatcttttttgtagagggtgaa
aatgtccgaaaagaagtttcttcaatgccgggtgtttatcacatttcagtggaccttgta
aaagaagaagtcaaagagcttgtcgacctaggtatcaaatcaattattgtatttggtgtt
ccagatcataaagaccatgtgggcagtgaggcgtatcacgaccatggcattgtgcaaaga
gcgacgcttgagatcaaaaagcatttcccagagcttgtggtcattgcagacacttgctta
tgccaatatacagatcatggacattgcggaattgttgaagatggagagattttaaatgat
gaatcacttcagctattagcgaaaaccgctgttagtcaagcaagcgcaggtgcagatatc
attgctccttctaatatgatggatggatttgttgtggccattcgtgaagcgcttgatgaa
gctggctttattcatgtacccgtcatgtcatatgctgtgaaatatgcaagtgcgttttat
ggtccgtttcgtgatgcggcgcatagcacaccgcagtttggagatcgtaaaacataccaa
atggaccctgcaaaccgtttagaagcattaagagaagcgcaatctgacgtagaagaggga
gctgacttcctcattgtgaaaccatccctttcttatttagatatcatgcgtgatgtgaaa
aatgaatttacactccctgttgttgcttacaatgtgagcggagaatatgcaatggtcaaa
gccgctgctcaaaatgggtggatttctgaaaaagagcttgttcttgaaatgctgacaagc
atgaaacgtgcaggagcagaactcatcattacgtatcatgcaaaagatgcagcaaaatgg
ctctcagaataa

DBGET integrated database retrieval system