KEGG   Bacillus pumilus SAFR-032: BPUM_2455Help
Entry
BPUM_2455         CDS       T00599                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00860  Porphyrin and chlorophyll metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_2455
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPUM_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABV63118
UniProt: A8FFV1
Position
complement(2464091..2464882)
Genome map
AA seq 263 aa AA seqDB search
MTIGQSLHGQTVLVTRNERQAGVFQQKIEELNGHAILTSLIRFEPTLTNEKAQAFLKDLE
NSQWLVFTSVNGASFFLSYIEDHHLHKSLSHLKVAAVGEKTSAYLEQHGLKVDVVPGRFI
AEELADALLDHVQLGERVFVAKGHLSRDVVKKTLVPLGIEVKEWILYETVKDEEGIAALK
TEMTKQSFDFITFTSSSTVHSFMHAMEADAANLAASDTCFVTIGPLTKEALLQYGISSET
PDTYTIDGMLELMCRLSERKLNK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccataggccaatcgcttcacggacagacggtgcttgtcactcgaaatgaacgtcaa
gcgggtgtgtttcagcagaagattgaagagctgaacggccatgctattttaacctctctt
attcggtttgagcctacgctcacaaatgaaaaagcgcaggcctttttaaaagacttagaa
aatagccaatggcttgttttcacaagtgtaaatggtgcgtctttttttctgagctacata
gaggaccatcatttacataaaagtttatcccatttgaaagtggctgcggtaggtgagaaa
acctctgcctaccttgagcagcacggcttgaaggtggatgtcgtaccaggacgattcata
gcggaagagctcgctgatgcgctgcttgaccatgtgcagctaggagagcgtgtgtttgta
gcaaaaggacacctgtctcgagatgtcgtgaagaaaacgcttgttccacttggcatagaa
gtaaaggaatggattttatatgaaacggtcaaggatgaggaagggattgccgctcttaaa
acggaaatgacgaagcaatcatttgattttataacatttacgagctcatcgactgtccat
tcatttatgcatgctatggaggcagatgcagcgaatctagctgcttctgacacttgtttt
gtgacgatcggtcctctaacaaaagaggcactgcttcaatacgggatttcttctgaaacc
ccagatacttatacgatagacggaatgcttgaattgatgtgccgtttatctgaaaggaag
ttgaataaatga

DBGET integrated database retrieval system