KEGG   Bacillus pumilus SAFR-032: BPUM_2455Help
Entry
BPUM_2455         CDS       T00599                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_2455 (hemD)
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPUM_2455 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2463915..2464706)
Genome map
AA seq 263 aa AA seqDB search
MTIGQSLHGQTVLVTRNERQAGVFQQKIEELNGHAILTSLIRFEPTLTNEKAQAFLKDLE
NSQWLVFTSVNGASFFLSYIEDHHLHKSLSHLKVAAVGEKTSAYLEQHGLKVDVVPGRFI
AEELADALLDHVQLGERVFVAKGHLSRDVVKKTLVPLGIEVKEWILYETVKDEEGIAALK
TEMTKQSFDFITFTSSSTVHSFMHAMEADAANLAASDTCFVTIGPLTKEALLQYGISSET
PDTYTIDGMLELMCRLSERKLNK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccataggccaatcgcttcacggacagacggtgcttgtcactcgaaatgaacgtcaa
gcgggtgtgtttcagcagaagattgaagagctgaacggccatgctattttaacctctctt
attcggtttgagcctacgctcacaaatgaaaaagcgcaggcctttttaaaagacttagaa
aatagccaatggcttgttttcacaagtgtaaatggtgcgtctttttttctgagctacata
gaggaccatcatttacataaaagtttatcccatttgaaagtggctgcggtaggtgagaaa
acctctgcctaccttgagcagcacggcttgaaggtggatgtcgtaccaggacgattcata
gcggaagagctcgctgatgcgctgcttgaccatgtgcagctaggagagcgtgtgtttgta
gcaaaaggacacctgtctcgagatgtcgtgaagaaaacgcttgttccacttggcatagaa
gtaaaggaatggattttatatgaaacggtcaaggatgaggaagggattgccgctcttaaa
acggaaatgacgaagcaatcatttgattttataacatttacgagctcatcgactgtccat
tcatttatgcatgctatggaggcagatgcagcgaatctagctgcttctgacacttgtttt
gtgacgatcggtcctctaacaaaagaggcactgcttcaatacgggatttcttctgaaacc
ccagatacttatacgatagacggaatgcttgaattgatgtgccgtttatctgaaaggaag
ttgaataaatga

DBGET integrated database retrieval system