KEGG   Bacillus pumilus SAFR-032: BPUM_2490Help
Entry
BPUM_2490         CDS       T00599                                 

Gene name
ysnA
Definition
nucleoside-triphosphatase
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPUM_2490 (ysnA)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BPUM_2490 (ysnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500121..2500714)
Genome map
AA seq 197 aa AA seqDB search
MKTAIIATHNAGKAKEFKAILEPKGFTVKTLADIGFIEEIEETGHTFEENAVIKAEAIQA
KAGEMVIADDSGLSIDYLGGKPGVYSARYAGEHKNDAENVEKVLSELQGIEKEDRTARFR
CALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPEEKNKIS
HRAVALQKLSSLLDANE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccatcattgcaacgcacaatgcgggcaaagcgaaagaattcaaagccatt
cttgagccaaaaggattcacggtcaaaacactagcagacatcggctttattgaagaaatt
gaagaaacaggacataccttcgaagaaaatgccgtcatcaaagccgaggcgattcaagcc
aaagcgggtgaaatggtcattgcagacgattccggtttgtcgattgattatcttggcgga
aaacctggcgtctattcagcgagatacgctggtgagcataaaaatgatgctgagaatgta
gaaaaagtgctgagcgaacttcaaggcattgaaaaagaagaccgcacagctagattcaga
tgtgccctagctgtcagcataccaggcaaagaaacaaaaacggtagaaggatcagtagaa
ggctttatcgcagaggaaccaatcggcgaaaatggcttcggatatgacccgattttcatc
gtcaaagacaaagaccagacaatggccgaattatcaccagaggagaaaaataagatcagc
catcgagcggtcgcgcttcaaaagctttcatcactgctagacgcaaatgaataa

DBGET integrated database retrieval system