KEGG   Bacillus pumilus: BPUM_2490Help
Entry
BPUM_2490         CDS       T00599                                 

Gene name
ysnA
Definition
nucleoside-triphosphatase
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
bpu  Bacillus pumilus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bpu00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500121..2500714)
Genome map
AA seq 197 aa AA seqDB search
MKTAIIATHNAGKAKEFKAILEPKGFTVKTLADIGFIEEIEETGHTFEENAVIKAEAIQA
KAGEMVIADDSGLSIDYLGGKPGVYSARYAGEHKNDAENVEKVLSELQGIEKEDRTARFR
CALAVSIPGKETKTVEGSVEGFIAEEPIGENGFGYDPIFIVKDKDQTMAELSPEEKNKIS
HRAVALQKLSSLLDANE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccatcattgcaacgcacaatgcgggcaaagcgaaagaattcaaagccatt
cttgagccaaaaggattcacggtcaaaacactagcagacatcggctttattgaagaaatt
gaagaaacaggacataccttcgaagaaaatgccgtcatcaaagccgaggcgattcaagcc
aaagcgggtgaaatggtcattgcagacgattccggtttgtcgattgattatcttggcgga
aaacctggcgtctattcagcgagatacgctggtgagcataaaaatgatgctgagaatgta
gaaaaagtgctgagcgaacttcaaggcattgaaaaagaagaccgcacagctagattcaga
tgtgccctagctgtcagcataccaggcaaagaaacaaaaacggtagaaggatcagtagaa
ggctttatcgcagaggaaccaatcggcgaaaatggcttcggatatgacccgattttcatc
gtcaaagacaaagaccagacaatggccgaattatcaccagaggagaaaaataagatcagc
catcgagcggtcgcgcttcaaaagctttcatcactgctagacgcaaatgaataa

DBGET integrated database retrieval system