KEGG   Bacillus pumilus SAFR-032: BPUM_2511Help
Entry
BPUM_2511         CDS       T00599                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BPUM_2511 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    BPUM_2511 (ysiB)
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPUM_2511 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2521152..2521931)
Genome map
AA seq 259 aa AA seqDB search
MEKILTLHHEGQTALITIQHPPANALSSQLLSELNDMFDQLEQNEEVRAIVIHGEGRFFS
AGADIKEFTTLQEESDYSSLADRGQQVFERIEQCPKPVIASIHGAALGGGLELAMSCDIR
IATKDAKLGLPELNLGIIPGFGGTQRLPRYVGSAKALEMMGTAEPITGEEAFACGLVSKL
AETEEEALEAAKTLASKFATKSPKSLEYVLDLLNATKLYSYDGGMKLEAKKFGEIFQSND
AKEGIQAFIEKRKPNFKGE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatactcaccttacatcatgaaggacagacagcacttatcacgattcagcat
ccaccagcaaacgccttatcttctcagctgcttagcgagctgaatgacatgtttgaccag
ctcgaacaaaatgaagaagtaagagccattgtgattcacggggaaggaagatttttctca
gcaggtgctgatattaaggaatttacgaccttgcaggaagagtctgactattcaagcctt
gcagacagaggacagcaggtctttgaacggattgaacaatgtccgaaaccggtcattgct
tcaattcacggagctgcattaggcgggggccttgagcttgccatgtcttgtgatatacga
atcgcaacaaaagatgcgaagcttggactgccagaactaaacctcggtatcattccagga
ttcggcggtacgcagcgcctaccgcgctatgttggttctgcaaaagcgctagaaatgatg
ggtacagctgaaccgattacaggagaagaagcatttgcttgcggacttgtgtcaaagctg
gcagaaacagaggaagaggcgctcgaagcagccaaaacacttgcgtcaaaatttgcaacg
aaaagtccaaaatcactcgaatatgtgctggatttattgaatgcgacaaaattgtattca
tatgacggcggtatgaagctagaagccaaaaagttcggtgagattttccaatcgaatgat
gccaaagaaggtattcaagcctttatcgaaaagcgcaaaccaaattttaaaggggaataa

DBGET integrated database retrieval system