KEGG   Bacillus pumilus SAFR-032: BPUM_2527Help
Entry
BPUM_2527         CDS       T00599                                 

Gene name
ysdC
Definition
M42 family glutamyl aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPUM_2527 (ysdC)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BPUM_2527 (ysdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2538779..2539867)
Genome map
AA seq 362 aa AA seqDB search
MTKLDQTLTMLKDLTDAKGIPGNERDVKKVMQTYIGSYADEVSSDRLGSLIAKKEGNANG
PKIMLAGHLDEVGFMVTKIDDKGYIRFQTVGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHVLSPEARKKSIEIKDMFIDIGASSKEQAMEWGVLPGDQIVPYFEFTVMNDEKMLLAKA
WDNRIGCAVAIDVMKNLHNTQHENIAYSVATVQEEVGLRGAKTAASTIQPDIGFAIDVGV
AGDTPGITEKEATSKLGKGPTIVVFDASMVSHKGLRDFVVQTADELNIPYQYDSMPGGGT
DAGGIHLTGHGVPSLSIGIPSRYIHTHAAMIHRDDYENAVKLLTEVIKRLDQKTVEQITY
GS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagctagatcaaacattaactatgctgaaagacctaacggatgcaaaagggatt
ccaggaaatgaacgtgatgtcaaaaaagtcatgcagacatacataggatcatatgcagat
gaagtctctagtgaccgccttggcagcttaatcgctaagaaggaaggaaacgcaaacgga
cctaaaattatgcttgctggtcacttggatgaagtcggattcatggtgacaaaaattgat
gacaaaggctacattcgtttccaaactgtcggtggatggtggtcacaggtcatgctcgcg
cagcgtgtcaccattgtaacgaaaaagggagacattacaggggtgattggctcaaagccg
ccacacgtcttgtcacctgaagcacgaaaaaagtcgattgagattaaagatatgtttatt
gatatcggtgcatcaagcaaagaacaggcaatggagtggggcgttctgcctggagatcaa
atcgttccttattttgagtttacagtgatgaatgatgaaaaaatgctccttgcaaaagca
tgggacaaccgtatcggctgtgcagtagcgattgatgtcatgaagaacttacacaatact
cagcatgagaatattgcttatagtgttgcaactgtacaagaggaagttggcctgcgtggt
gccaaaacagcagcgtctacaattcagcctgatattggatttgccattgatgttggtgta
gcaggagacacgccgggcatcactgaaaaagaagcaacgagcaaacttggcaaagggccg
acgattgttgtatttgatgcttcgatggtatctcataaagggcttcgcgattttgttgtc
caaacagcggatgaattgaacatcccttaccaatatgattccatgcctggcggcgggaca
gatgctggcggtatccatttaacaggtcatggtgtgccatcactatcgatcgggatacca
agcagatatatccatacccatgctgcgatgattcaccgagatgattatgaaaatgcagtg
aagcttttaacagaagtgatcaaaagacttgatcaaaaaacggttgagcagatcacgtac
ggttcttaa

DBGET integrated database retrieval system