KEGG   Bacillus pumilus SAFR-032: BPUM_2527Help
Entry
BPUM_2527         CDS       T00599                                 

Gene name
ysdC
Definition
(GenBank) M42 family glutamyl aminopeptidase
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2538779..2539867)
Genome map
AA seq 362 aa AA seqDB search
MTKLDQTLTMLKDLTDAKGIPGNERDVKKVMQTYIGSYADEVSSDRLGSLIAKKEGNANG
PKIMLAGHLDEVGFMVTKIDDKGYIRFQTVGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHVLSPEARKKSIEIKDMFIDIGASSKEQAMEWGVLPGDQIVPYFEFTVMNDEKMLLAKA
WDNRIGCAVAIDVMKNLHNTQHENIAYSVATVQEEVGLRGAKTAASTIQPDIGFAIDVGV
AGDTPGITEKEATSKLGKGPTIVVFDASMVSHKGLRDFVVQTADELNIPYQYDSMPGGGT
DAGGIHLTGHGVPSLSIGIPSRYIHTHAAMIHRDDYENAVKLLTEVIKRLDQKTVEQITY
GS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagctagatcaaacattaactatgctgaaagacctaacggatgcaaaagggatt
ccaggaaatgaacgtgatgtcaaaaaagtcatgcagacatacataggatcatatgcagat
gaagtctctagtgaccgccttggcagcttaatcgctaagaaggaaggaaacgcaaacgga
cctaaaattatgcttgctggtcacttggatgaagtcggattcatggtgacaaaaattgat
gacaaaggctacattcgtttccaaactgtcggtggatggtggtcacaggtcatgctcgcg
cagcgtgtcaccattgtaacgaaaaagggagacattacaggggtgattggctcaaagccg
ccacacgtcttgtcacctgaagcacgaaaaaagtcgattgagattaaagatatgtttatt
gatatcggtgcatcaagcaaagaacaggcaatggagtggggcgttctgcctggagatcaa
atcgttccttattttgagtttacagtgatgaatgatgaaaaaatgctccttgcaaaagca
tgggacaaccgtatcggctgtgcagtagcgattgatgtcatgaagaacttacacaatact
cagcatgagaatattgcttatagtgttgcaactgtacaagaggaagttggcctgcgtggt
gccaaaacagcagcgtctacaattcagcctgatattggatttgccattgatgttggtgta
gcaggagacacgccgggcatcactgaaaaagaagcaacgagcaaacttggcaaagggccg
acgattgttgtatttgatgcttcgatggtatctcataaagggcttcgcgattttgttgtc
caaacagcggatgaattgaacatcccttaccaatatgattccatgcctggcggcgggaca
gatgctggcggtatccatttaacaggtcatggtgtgccatcactatcgatcgggatacca
agcagatatatccatacccatgctgcgatgattcaccgagatgattatgaaaatgcagtg
aagcttttaacagaagtgatcaaaagacttgatcaaaaaacggttgagcagatcacgtac
ggttcttaa

DBGET integrated database retrieval system