KEGG   Bacillus pumilus: BPUM_2562Help
Entry
BPUM_2562         CDS       T00599                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpu  Bacillus pumilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:bpu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bpu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2573050..2574009)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGKGGRCVGIQSNELVHHDILDIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaaggaaagcaatttaccataatgttgaagtttacggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaacttgaaataggttcagttggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgccctgaattcaagacagttgaa
ggtcgtgaaaaaggcattgagaacttaaaaaaattcggtattgaaggacttgttgtgatc
ggcggagacggttcattcatgggagcgaagaaattaacggagctcggttttccatgtgta
ggtgtcccaggtacaatcgacaacgatatcccaggtactgatttcactattggctttgat
acagcactgaatacagtcattgacgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagtggaagtaatgggaagacatgctggtgatattgctctttggtca
ggtcttgcaggcggagccgaatcgattttgattcctgaagcagactatgacatggatgaa
attattgcgagattaagaagagggcacgagcgcggcaagaagcacagtatcatcatcgtc
gcagaaggcgtaggcagcggtgttgaatttggtaagcggattgaagaggagacaagcctt
gaaacccgtgtatctgtcttaggacatattcagcgcggaggttctccaagtgcgtttgac
cgagtactcgcaagccgtttaggagcatacgcagtagaacttcttcttgaaggaaaaggc
ggacgctgtgtaggtattcaaagcaacgaactcgttcaccacgatattttagatatctta
gataaaaaacatacagtcgatcaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system