KEGG   Bacillus pumilus: BPUM_2645Help
Entry
BPUM_2645         CDS       T00599                                 

Gene name
ytjP
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpu  Bacillus pumilus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2657331..2658740)
Genome map
AA seq 469 aa AA seqDB search
MEKMNWEAEVIRKKDDLIKDTQSFLQIESVLDEEGGKEGKPFGEKVDQALQYMLKKGEDE
GFTVKNVDGYAGHIEYGEGEDIVGVLCHVDVVPAGDGWTTPPFSADIRENKIFARGAIDD
KGPTMAAFYALKMLKDTGMKLSKKIRMIIGTDEESDWRCVDHYFKHEAMPQIGFAPDADF
PIIHAEKGIIDAIVSFTYQHTEQHQRYTLKQFTSGMRLNMVPDEATATVTAAQDHDVESL
KTAFEAYLADNQLSGEVKIAANELHFTLKGESVHAMEPANGINAGIHMANFLSGQELDQD
GLAFTSQINALFDQDTRGKKLGIACKDDISGDLTLNVGTIRYTQNEEAKLGLNVRYPVTA
DGKDVKKGIEGIKGATLLKFDDSPPHHVSKDHPLVKTLQRVYEEQTGNPAHLIAIGGGTY
ARSLEAGVAFGPLFPGRPDCAHQKDEYIEIDDLLRATALYAQAMYELAK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgaattgggaagctgaagtcatacgaaaaaaagacgatttgattaaggac
acacaatcttttttacaaattgagagtgtgctggatgaagaaggtggaaaagaaggaaag
ccatttggtgaaaaagtcgatcaagcccttcagtatatgctgaaaaaaggggaggacgaa
ggcttcacagtcaagaatgtggatggctatgcaggtcatattgaatatggagaaggcgaa
gacattgtaggtgtgctctgccatgtggacgttgtacctgctggtgacggctggacaacc
ccgccgttttcagcagacataagagaaaataaaatatttgcacgaggcgccattgatgat
aaaggaccaactatggcggctttctacgcgctaaagatgttaaaagatacagggatgaag
ctgtcaaaaaagattcgaatgatcattggaacagatgaagaaagtgattggcgctgtgtg
gatcattatttcaagcatgaggcgatgccgcaaattggatttgccccagatgctgatttt
ccgattattcatgctgaaaaagggatcattgatgccattgtgtcatttacatatcaacat
acagaacaacatcagcgctatacactcaagcaattcacatcaggtatgcggctgaatatg
gtgccggatgaggcaactgccactgtgacagcggcacaagaccacgatgttgaatcatta
aaaacagcttttgaagcatatcttgctgacaatcaattatcaggtgaggtaaagattgca
gcgaatgaactacatttcacattaaaaggcgaatcagttcatgccatggagcctgcaaat
ggcataaatgcgggcattcatatggccaatttcctcagtggacaagaattagatcaagac
gggcttgcttttacttctcaaatcaacgctttatttgatcaagatacaagagggaaaaag
ctggggattgcttgcaaagatgatattagcggagatttaactttaaatgttggcacgatc
cgctatacacaaaacgaagaagcgaagctaggattaaatgtccgctatccagtgacagca
gatggcaaggacgttaaaaaagggatcgaaggcatcaaaggggccacccttctgaaattt
gacgacagccctccgcatcacgtctcaaaagatcatccacttgtgaaaacattgcaacgg
gtatatgaggaacaaactggaaatccagctcatctgattgcaattggtggagggacgtat
gcaagatctttagaagcgggcgttgcctttggtcctctcttccctggcagaccagattgc
gcacatcagaaggatgaatatatcgaaatcgacgatctactaagagcaaccgcactatat
gcacaagccatgtatgaattggcaaaatag

DBGET integrated database retrieval system