KEGG   Bacillus pumilus SAFR-032: BPUM_2683Help
Entry
BPUM_2683         CDS       T00599                                 

Gene name
ytpA
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BPUM_2683 (ytpA)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BPUM_2683 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2695124..2695903)
Genome map
AA seq 259 aa AA seqDB search
MWTWHAERPVGTIVIVHGASEYHGRYKWLIEMWRNAGYHVVMGDLPGQGTSTRARGHIRS
FQEYIDTVDEWIEHAKSFRLPTFLLGHSMGGLISIEWVKQYTHTKIDGLILSSPCLGLQF
KPKKLMDFASKGLNVLAPSFKVESGLSIELATRNQAVIEADSNDSLYVTKVSVRWYRELI
KNIDAAMQPTNVFKTIPLLLMQAGDDKIVDKTRVIKWFNGIESTNKSYREWEDLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgtggacttggcatgctgaaagaccagttggtacaattgtgatagtacatggtgcaagt
gaatatcacggccgatataaatggctgatcgaaatgtggcgaaatgccggctatcacgtc
gtcatgggtgacctgcctgggcaagggacatcgacacgtgcgcgcggccacattcgttcg
tttcaagaatacattgatacagtagatgaatggatcgaacatgcgaaatcattcaggctt
cctacttttttacttggacacagtatgggcggactcatttcaattgagtgggtcaagcag
tatacccatacgaagattgatggccttattttatcatcaccttgtttaggtctgcaattt
aaaccgaagaagctaatggattttgcatcaaaaggtttaaatgtgctcgcaccgtccttt
aaagtcgagtcagggctgtcgattgaactagccacacgaaatcaggctgtgattgaagca
gactccaatgactccctttacgtaacaaaggtgtcggttcgctggtaccgagagctgatc
aaaaatattgatgcggccatgcagccaacgaatgtttttaaaacaattccgctcctttta
atgcaggcgggtgatgataagatcgtcgacaagacgagggtgattaaatggttcaatggc
attgaatcaaccaataagtcatatcgtgaatgggaagacctgtatcacgaaatttttaat
gaaccggaaagagaagatgtgtttaaggcagcaagagcctttacagatcaatatatttga

DBGET integrated database retrieval system