KEGG   Bacillus pumilus: BPUM_3032Help
Entry
BPUM_3032         CDS       T00599                                 

Gene name
bioH
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpu  Bacillus pumilus
Brite
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BPUM_3032 (bioH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3018615..3019361)
Genome map
AA seq 248 aa AA seqDB search
MKVVTPKPFTFKGGEKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHFGPDDWWKDVQEAYQFLKDEGFEEIAVCGLSLGGVFSLKLGYTVPVKGIVPMCAPMYI
KSEEVMYQGVLEYARNYKKFEGKSEDQIEQEMEEFKKTPMDTLKSLQALIADVRNNVDMI
YSPTFVVQARHDHMINTDSANIIYNEVETDQKHLTWYEESGHAITLDKEREKVHQDVYAF
LESLDWSI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttacaccaaaaccatttacgtttaaaggtggagaaaaggcggtgcttctt
cttcacggttttactgggaatacagccgatgttcgaatgctaggccgttatttgaacgaa
agaggctatacgtgtcatgcaccacaatataaaggacacggtgtgccaccagaagagctt
gtccattttggaccggatgactggtggaaggatgtacaagaagcctatcaattcttgaaa
gatgaaggctttgaggaaattgcggtttgcggactatccctcggaggagttttttcattg
aaattaggttacactgtacctgtaaagggaattgtacctatgtgtgcacctatgtacata
aaaagtgaagaagtcatgtaccagggtgtactagaatatgcccgtaactataagaaattc
gagggtaagtcagaggaccaaattgaacaggaaatggaagagttcaagaaaacgccaatg
gatacacttaagagccttcaagcactcattgcagatgttagaaacaatgtcgacatgatt
tattcacctacttttgttgttcaggcacgtcacgatcatatgattaatacagacagtgcg
aatatcatctataacgaagtagagacagatcaaaagcatttgacatggtatgaagaatca
ggccatgcgatcacgcttgataaagagcgcgagaaggttcatcaggatgtatatgcattc
ttagaatcacttgattggtcaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system