KEGG   Bacillus pumilus SAFR-032: BPUM_3055Help
Entry
BPUM_3055         CDS       T00599                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPUM_3055 (tpiA)
   01230 Biosynthesis of amino acids
    BPUM_3055 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_3055 (tpiA)
   00051 Fructose and mannose metabolism
    BPUM_3055 (tpiA)
   00562 Inositol phosphate metabolism
    BPUM_3055 (tpiA)
Enzymes [BR:bpu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BPUM_3055 (tpiA)
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BPUM_3055 (tpiA)
  Exosomal proteins of bladder cancer cells
   BPUM_3055 (tpiA)
  Exosomal proteins of melanoma cells
   BPUM_3055 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3034275..3035036)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPYPDKVEAIVCAPALFLEKLNSLSNGTDLK
IGAQNMHFEENGAFTGEISPAALKDLGIGYSVIGHSERREFFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNELVADQVKKALAGFTTQQVAESVIAYEPIWAIGTGKSSTA
KDANDVCAHIRQTVASEYGQEAADSLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagctgggaactggaaaatgaacaaaacacttggcgaagcggtt
agcttcgttgaagaagtcaagtcatccattccatatcctgacaaagtggaagcaattgtc
tgtgcgccagcccttttccttgaaaagctcaacagcctttctaacggaacagaccttaaa
attggtgcacaaaacatgcactttgaagaaaacggtgcattcactggtgaaatcagccct
gctgcactaaaagatcttggcatcggctactcagtgatcggtcattcagagcgccgggag
ttctttgctgaaacagatgaaacagtgaacaaaaaagcacatgctgcattcaagcatggc
atcgttccaattatctgtgtaggtgaaacgcttgaagagcgtgaagctggcaaaacaaat
gaacttgttgctgatcaagtgaagaaagcactagctggtttcacaactcagcaagtcgct
gaatctgttatcgcatatgagccaatttgggctattggtacagggaaatcttctacagcg
aaagatgcaaacgacgtttgcgcgcatatccgtcaaacggttgcaagcgaatatggtcaa
gaagcggcagacagccttcgcattcaatatggcggaagcgtgaaacctgcgaatattaaa
gaatatatggcagaatccgatattgacggtgctttggtaggcggcgcaagcttagaacct
cagtctttcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system