KEGG   Bacillus pumilus SAFR-032: BPUM_3126Help
Entry
BPUM_3126         CDS       T00599                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00340  Histidine metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01230  Biosynthesis of amino acids
Module
bpu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BPUM_3126
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BPUM_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABV63780
UniProt: A8FHR3
Position
complement(3101135..3102424)
Genome map
AA seq 429 aa AA seqDB search
MNITYIKEGDTDTLSLKRTLDTGTEEQRLAVQRIIQEVRINGDQAVQSFTKQFDGVLLED
PLVTEEEMTKAFERLDPAVIQVIQTAIRNIRTYHERQLTSSWFYHQQDGSMLGQKVTPLD
AVGVYVPGGTAAYPSSVLMNVIPALVAGVQRIVLVTPPGKDGCLSDAVLVAAKELGISEM
YKMGGAQAIATLAYGTETIQPVDKITGPGNIYVALAKREVFGQVDIDMIAGPSEIAVLAD
DTAIAHEVAADLLSQAEHDALSSSILVTPSQTLAENVQAEVQAQLDTLPRKSIAAQSIKH
HGRIYVTDSMDRAVDVVNQLAPEHLEVLTAYPESFLGQIKHAGAIFLGRYSPEPVGDYFA
GPNHVLPTNGTARFSSPLGVTDFQKKTSIISYSQEAFETHRDSIAAFARLEGLEAHARSI
ESRKREESS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcacctacataaaagaaggtgacacagacacactctcactcaaacggacttta
gatacgggcacggaagagcagcgcctggctgttcagcggattatacaagaagtgagaata
aatggcgatcaagcggtacagtcttttacaaagcaatttgatggggtgctgcttgaagat
ccgcttgtcacagaggaggaaatgacaaaagcctttgaacgcttggacccagccgtgatt
caggtgatccaaacggctatccgcaatattcgcacataccatgagcgtcagctaacatcc
tcttggttttatcatcagcaagatggctcgatgcttggacaaaaggtgacaccgcttgat
gcagttggtgtgtatgtccccggtggaaccgctgcttatccatcatctgttttaatgaat
gtcattccggcgcttgtcgctggtgttcagcgaattgtccttgtgacaccaccagggaaa
gacggttgcctatctgatgctgtactcgttgctgcgaaggagctcggtatttctgagatg
tataaaatgggcggtgcacaggcgattgcgacacttgcctatggaacagaaaccattcag
cctgttgataaaattactggtccaggcaacatctatgtcgcactggcaaagcgggaagta
tttggtcaggtcgacattgatatgattgcgggtccaagtgaaattgcggttctagcagac
gacacggctatagctcatgaggtggcggctgatttactttctcaggcagagcatgatgcg
ctgtcatctagtattttggtcaccccgtctcaaacacttgcggaaaacgtgcaagctgag
gtgcaagcgcagctagacaccttaccaagaaaatcaatcgctgcacaatctataaaacat
catggccgtatatatgtgacggattccatggatcgtgcagtagacgtcgtcaatcagtta
gcgccagagcatttagaggtgctgacagcctatccagaatcatttcttggtcaaattaag
catgcaggggcgatttttttagggcgttatagccctgagccggtgggagattattttgca
ggaccaaatcacgtgctgccaaccaacggaacagctagattttctagcccactcggtgtg
accgattttcaaaagaaaacgagcattatttcatatagtcaagaagcctttgagacacat
agggatagcattgcggcttttgccagattagaagggctcgaagcgcatgcaaggtcgatt
gaatcgagaaagcgggaggaatcgtcatga

DBGET integrated database retrieval system