KEGG   Bacillus pumilus: BPUM_3219Help
Entry
BPUM_3219         CDS       T00599                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpu  Bacillus pumilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPUM_3219 (gtaB)
   00052 Galactose metabolism
    BPUM_3219 (gtaB)
   00500 Starch and sucrose metabolism
    BPUM_3219 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BPUM_3219 (gtaB)
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BPUM_3219 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3193001..3193882
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKG
KRAIEDHFDFAPELERNLEEKGKKELLEKVRKSSNIADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSVIGVQQVADHDTHRYGIIDPLTQEG
RRYQVKNFVEKPPQGTAPSNLAILGRYIFTPEIFMYLEQQEIGAGGEIQLTDAIQKLNDI
QRVFAYDFEGKRYDVGEKQGFIETTLEFALQDEDLKKKLIPFMKQLLEKEEVN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtacggaaagccattataccagctgcaggtctcgggacacgtttcctccct
gcaacaaaagccatgcctaaagagatgctcccaatcgttgataaaccaaccattcaatat
attattgaagaagctgttgaatcaggaatcgaagacattattatcgtcactggaaaagga
aaaagagcaattgaagatcattttgattttgctccagaacttgagcgtaacctagaggaa
aaagggaaaaaggagctgttagaaaaagtaaggaaatcttctaacattgctgatatccac
tacattcgtcaaaaagaaccaaaaggtcttggtcatgctgtttggtgtgcaagaaacttt
atcggtgatgagccttttgctgttttattaggtgatgacattgttcaagccgaaacacct
gggctccgccagctgatggatgaatacgaaaaaactctatcatctgtcattggtgttcag
caagtagcagatcacgatacgcatcgctacgggattatcgatcctcttacacaagaagga
cgccgttaccaagtgaaaaactttgttgaaaagccgccgcaaggaacagcaccatcgaat
ctagccattttaggacgctacattttcacgccagagatcttcatgtacctcgaacagcaa
gagattggtgcaggtggggaaattcagctgacagatgccatccagaagctgaatgacatc
cagcgagtattcgcctatgattttgaaggaaaacgatacgatgtcggtgagaagcaaggc
ttcatcgagacaacgcttgaatttgcccttcaagatgaggatctgaaaaagaaactcatt
ccatttatgaaacagcttctcgaaaaagaagaagtgaattaa

DBGET integrated database retrieval system