KEGG   Bacillus pumilus: BPUM_3264Help
Entry
BPUM_3264         CDS       T00599                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpu  Bacillus pumilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BPUM_3264 (rbsK)
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BPUM_3264 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3251253..3252131
Genome map
AA seq 292 aa AA seqDB search
MSHIVVVGSCSMDLVVTSNKRPNAGETVLGESFKTVPGGKGANQAVASARLGADVYMIGR
VGDDTYGQDILSNLQDQGVRTSYMKPVTEMESGTAHIILAEGDNSIVVVKGANNEVTPDY
VREALSTIDDIGMVLIQQEIPEETVEAVCAICSKKEIPVILNPAPARKVSQQVLDQATYI
TPNEHEAVLMFNGRSIEDALRQYPNKLLITEGKNGVRYFDGLKEVLVPGFPVEAVDTTGA
GDTFNGALAVALTEGKSLYDALAFANLAASMSVTKFGAQGGMPTREELERKK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatattgtcgtagtaggaagctgctctatggatttagtcgtcacttcgaataaa
cgaccaaatgccggtgaaacagtgttaggcgaatcatttaaaaccgtcccaggtggaaaa
ggcgccaatcaagcagtcgccagtgcaaggctcggtgctgatgtatacatgatcggccga
gtcggtgatgacacttatggtcaagatattctcagcaatttacaagatcaaggggttcgc
acctcatatatgaaaccggttaccgaaatggaaagcggcacggctcatatcattttagca
gaaggtgataacagcattgtcgtggtcaaaggggcaaataacgaggtcactcctgactat
gtaagagaagcactttctacaatagatgatattggaatggtgctcattcagcaggaaata
cctgaagaaacggtcgaagctgtctgcgccatttgcagcaaaaaagaaatccctgtgatt
ttaaaccctgcacctgcccgcaaagtatcacagcaagtgttagaccaggctacctatatt
acaccgaatgagcacgaagctgttctcatgtttaatggacgctcaattgaagacgccttg
cgtcaataccctaacaaattactgattactgaaggaaaaaatggggttcgatattttgac
ggattgaaagaagtgctagtcccaggctttccagtcgaagcagttgatacaacaggagca
ggcgatacctttaacggagccttggctgttgccttaacagagggcaaatctctctatgac
gcacttgccttcgctaaccttgcagcatcaatgtctgtcaccaagttcggtgcacaaggc
ggcatgccaacaagagaagaactggagagaaagaaatga

DBGET integrated database retrieval system