KEGG   Bacillus pumilus SAFR-032: BPUM_3565Help
Entry
BPUM_3565         CDS       T00599                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_3565
   00500 Starch and sucrose metabolism
    BPUM_3565
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BPUM_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3527620..3529038)
Genome map
AA seq 472 aa AA seqDB search
MNKLEKTFPKGFLWGGAVAGNQIEGAYNKDGKGLSTADVSPHGIMHPFDESMKDLNLYHD
AIDFYHRYKEDIALFAEMGFKCFRLSISWPRIFPNGDDAEPNEAGLAFYDKVFDELLKHG
IEPVVTISHYEMPLALVKNYGGWRNRKLVDLYETYAKTLFTRYKDKVKYWMTFNEINVVL
HAPFTGGGLVFEEGDDEKSIQYQAAHHEFVASALAVKAGHEIIPDAKIGCMIAAMTTYPY
SSRPEDMFAAMDQDRKTLFFSDVQARGYYPGYMKRYFQENGIHIEIQDGDEDILRNHTVD
YIGFSYYMSFVTSTDPEVLGKVTGGNLFEGVKNPYLEASDWGWQIDPKGLRTTLNQLYDR
YQKPLFIVENGLGAVDQVEEDGSIQDDYRIDYLRSHLLEAREAIADGVDLMGYTSWGPID
LVSASTAEMKKRYGFIYVDRDNEGKGTLDRKKKKSFDWYKQVIATNGDHLDA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttagaaaaaacatttcctaaaggtttcttatggggcggcgctgttgcgggc
aaccaaattgaaggtgcttataataaagatggaaaaggcttatcgacagcagatgtatca
ccgcacgggattatgcatccattcgatgaatcaatgaaagacttaaacttatatcatgat
gcaattgacttctatcatcgctataaagaagatattgcactctttgcagaaatgggattc
aaatgcttcagactctctatttcttggccacgtattttcccaaatggcgacgatgcagaa
ccaaatgaagctggccttgctttttatgacaaagtattcgatgaactgcttaagcatgga
attgaaccagttgtcacaatttctcattatgaaatgccgcttgcacttgtgaaaaactac
ggcggttggagaaaccgtaagcttgtcgatctttatgaaacatacgcgaaaacgttgttt
actcgctataaagacaaagtgaaatattggatgacctttaatgaaatcaatgtcgtgtta
catgcgcctttcactggcggcggacttgtatttgaagagggtgatgacgagaaaagcatt
caatatcaagcagcgcatcatgaatttgttgcaagtgctttagctgtcaaagcaggccac
gaaatcattcctgatgcgaaaatcggctgtatgattgcagcgatgacaacttatccgtac
agctcaagaccagaagatatgtttgctgcaatggatcaggatcgtaaaacattgttcttc
tcagatgtacaggcaagaggctactacccaggttacatgaaacgatacttccaagaaaat
ggaattcatattgagatccaagatggtgatgaagacatcctaagaaaccatacagtagac
tatattggcttcagctattacatgagctttgtgacaagtacagatccagaggttcttgga
aaagtgactggtggtaacctatttgaaggcgtgaaaaacccttatctagaagcaagtgat
tggggatggcaaattgatccaaaaggacttcgtacaacactaaaccaactatatgaccgc
taccaaaaaccattgtttatcgtagaaaatggactgggagctgtcgatcaagtagaagaa
gacggatccattcaagacgattaccgaattgattacctcagaagccatttgctagaggcg
agagaagccattgcagacggagtagacttgatgggttatacaagctggggcccaattgac
cttgttagcgcatcaacagctgaaatgaaaaagcgctacggcttcatttatgtcgatcgt
gataacgaaggaaaaggtacattagatagaaagaaaaagaaaagcttcgattggtataaa
caagtgattgcgacaaatggtgatcatttagatgcataa

DBGET integrated database retrieval system