KEGG   Bacillus pumilus: BPUM_3617Help
Entry
BPUM_3617         CDS       T00599                                 

Gene name
lacA
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bpu  Bacillus pumilus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BPUM_3617 (lacA)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BPUM_3617 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3583616..3585682
Genome map
AA seq 688 aa AA seqDB search
MGKRYPLVHPNVNGFLHGGDYNPDQWLHMPEIIDEDFRLMKLAHCQTFSINIFGWSKLEP
EEGQYDFAWLDDIMDRLAAQGAHAILATPSGARPAWLSQTYPEVLRVEANRQRNLHGLRH
NHCFTSPIYREKTNTLNRLLAERYKDHPALIMWHISNEYGGECHCDLCQEAFRGYLKDKY
NHDLEALNQAWWTGFWSHTYSDWSQIESPAPHGEHMIHGMNLDWKRFVTAQTINFYQNEI
EPLRELTPHIPVTTNFMGDYPHMRPFLGLDYHQFAKEVDVISWDSYPAWHSGRETTAELA
SNVAFVHDLYRSLKDGQPFLVMESTPSLVNWHEVNKVKHKGMAHLSAIQAIAHGSDSVLY
FQWRQGRGASEKFHGAVVDHSGHEHTRVFQEVADLGKQLEHLQPIAGTSVQPEVAIIYDW
ENHWAIDDAQGLNNTNKRYVEACQTHYRSFWKKGIPVDIVGMEKDFSSYRVLIGPMLYMI
KPGVAEKIEAFVKTGGIFIATYWSGMVDENDLCFLGGFPGPLRHVLGIWAEEINTLMPDE
HVLMTTGNGRTYHVGQYCESIHPETASVLGHFENGCYEGQPALTVHSFGDGKAYYMASEN
EQIFYDEFYEDLIVGMDIQPVLSAEIPEGVSVQKRTDGSQDYVFMMNFTEKQQLLSLDSE
ESYQNMLTGQYVPQELQLDPYEYMIMKK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcgttacccactcgttcacccaaatgtgaatggctttttgcatggtggcgat
tataatccagatcaatggcttcatatgccggagatcattgacgaagattttcgattaatg
aagcttgcacactgtcaaacattctccatcaacattttcggatggagtaagctagagcca
gaagaaggtcagtatgattttgcatggctggatgatatcatggaccgcttggcagcacag
ggggcacatgccattcttgcaacgccaagcggggcgagacctgcttggctgtcacaaaca
tatcctgaggtattgcgcgtcgaagcgaaccgtcagcgtaatttacatggacttcgccat
aatcattgctttacctcaccgatttatcgagaaaaaacgaatacactcaatcgtttgctc
gctgaacgctacaaggatcacccagcactgatcatgtggcacatttcgaatgaatacggc
ggcgaatgtcattgcgacctctgccaagaagcatttcgagggtatttgaaagacaagtac
aatcatgaccttgaagctttaaaccaggcatggtggacgggattttggagccacacgtat
agtgattggtcacaaatcgagtcacctgcaccgcacggagagcacatgatacacgggatg
aatctagactggaaacgctttgtcacagcgcaaacgatcaatttttatcaaaatgaaatt
gaacctctgcgggaattgacgcctcacatcccagtgactaccaactttatgggcgactac
ccgcatatgcgaccatttcttggactggattatcatcaatttgccaaagaagtcgacgtg
atttcatgggatagctacccagcatggcatagcggcagggaaacaacggctgaattggcg
tcaaacgttgccttcgttcacgacttatatcgttcattaaaggacggtcagccatttctc
gtgatggagagtacaccgagccttgtgaactggcatgaagtgaataaggtcaaacacaaa
ggcatggcacatctttctgctatacaggcgattgcccacggatcagactccgtgctttac
ttccagtggcgccaagggcgcggtgcatctgagaaattccatggtgcggtagttgatcat
tctggacatgaacatacgcgcgtgtttcaagaggtcgctgatctagggaaacaactggag
catctgcagcccatcgcagggacttccgttcaaccagaagtcgccatcatatacgattgg
gaaaaccactgggccattgatgatgcacaaggcttaaataatacaaacaaacgctacgta
gaggcttgtcaaactcactatcgaagcttttggaaaaaaggcatccctgttgacattgtc
ggcatggaaaaggatttctcgtcctatcgtgtgctcattggtccaatgctttacatgatc
aaaccaggcgttgcagaaaaaatcgaagcctttgttaaaacgggcggtatttttatcgca
acctattggagcggtatggtcgacgaaaatgacctctgtttcctcggcggtttcccgggt
cctctccgccatgtacttggcatttgggcggaagaaatcaacacattgatgccagatgaa
catgtattaatgaccacaggaaatggacgcacctaccatgtcgggcaatattgcgaatcc
atacatcctgaaacggcctctgtgttagggcattttgagaatggatgctacgaaggacag
ccagctctgactgttcattcttttggagatggaaaggcatactatatggcttccgaaaat
gagcaaattttttatgatgagttttacgaggatctcatcgtaggaatggatatacagccc
gtcctatcagcggagattccagagggagtcagtgtccaaaaacgaacagatgggtcacag
gactatgtgtttatgatgaattttacggaaaaacaacagctcctttcactagattcagaa
gagagctatcaaaatatgctgacagggcaatatgtgcctcaagagctccagcttgatcct
tacgagtacatgattatgaaaaaatag

DBGET integrated database retrieval system