KEGG   Bacillus pumilus SAFR-032: BPUM_3722Help
Entry
BPUM_3722         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF951
Motif
Other DBs
NCBI-ProteinID: ABV64366
UniProt: A8FJE9
Position
complement(3689660..3689866)
Genome map
AA seq 68 aa AA seqDB search
MADKAFGLHDVVEMKKPHPCGVNRWKVIRLGMDIRIKCEGCGHSVMIPRRDFERKMKKIL
VKHEEPTA
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaagcgtttgggttacatgacgtcgttgaaatgaagaaaccccatccatgt
ggtgtcaatcggtggaaagtgattcgattgggcatggatattcgcattaaatgtgaaggc
tgcgggcatagcgtcatgattcccagaagagactttgaacgaaaaatgaagaaaattctc
gtcaagcatgaggagccaactgcttaa

DBGET integrated database retrieval system