KEGG   Bacillus pumilus SAFR-032: BPUM_3725Help
Entry
BPUM_3725         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease
Motif
Other DBs
NCBI-ProteinID: ABV64369
UniProt: A8FJF2
Position
complement(3691923..3692972)
Genome map
AA seq 349 aa AA seqDB search
MWKAGSRWTLLILGSLIGAGYASGQEIWQFFGIDSGLAILLFTLMFMLSTYVVLKISYEV
RADHFVPVLERLVGPWLAKVYDVLIVLYLFTTTTVMIAGGGVTLEMYHVPFWVGIGAFCL
FSFMIFFWDVKGLLSVNAFIIPILVAGLIYAFVFYYMNHDHMWRIDFGQQYNWPASIVFA
SLNILSVVAVLSSVGKEMKGLGEAKVASILSGLIFGVISYVYNEILVDISGSLSAEGIPL
FTVLEGAPTSLFVFMTVVLCLAIYTTTAAGLFGLSSRMLSFVPLPRWLVVLIMLLLMAPL
TSLGFADLIAFLYPIYSLLNLYLLVCLMLYPILSKKIFSHPKNYIDKIK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaggctggttcaaggtggacgcttttaattttaggaagcttaataggagcgggg
tatgcttccggccaagaaatttggcagttttttggcattgatagtggactagccattcta
ctgtttacattgatgttcatgctgtctacctatgtggtgttaaaaattagttatgaggta
cgtgccgatcactttgtgccagtgctagagcggcttgtcggtccatggctggctaaagtg
tatgacgttttaattgtcctttatttattcacgacaacgacagtcatgattgccggtggt
ggggtgacgctagagatgtatcatgtgccattttgggtgggtatcggtgccttttgtcta
ttttcatttatgatttttttctgggatgtgaaagggctcttatctgtgaatgctttcatt
ataccaattttggtggcggggctcatctatgcgtttgttttttattatatgaaccatgat
catatgtggcggattgattttggacagcagtacaattggcctgccagtattgtctttgct
tctttgaatatattatctgtggtcgcagtgctgtcttcggttgggaaagaaatgaaggga
cttggagaggcaaaagtggcgagtatattaagtggtctgatttttggggttatctcgtac
gtgtataacgaaatactggttgatatttctgggagcctatcagcagaaggcattcccttg
tttacagtattagaaggagcgccaacatcattgtttgtttttatgaccgttgtcctttgt
ctagccatttatacgacgacagcggcaggtttatttggtttatccagccgaatgctctct
tttgtaccattgcctcgatggttggtggtgctcataatgcttcttttaatggcgcctttg
acatctcttgggtttgccgatttgattgctttcttgtatccaatatatagcttgctgaat
ctgtatttgcttgtctgtttaatgctatatccgattttaagtaaaaagatattttctcac
cctaaaaattatattgataaaataaaataa

DBGET integrated database retrieval system