KEGG   Brachyspira pilosicoli WesB: WESB_0144Help
Entry
WESB_0144         CDS       T02412                                 

Gene name
bglH
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(157162..158556)
Genome map
AA seq 464 aa AA seqDB search
MNKCFPKGFLWGGAISANQAEGAYNLDDKGLSTADVSPNGVVFPPKLPFDSNIYNPFHSG
IDFYHNYKEDIKLLAELGINCFRTSIAWTRIFPTGIEDIPNEKGLEFYDKLFDELLKYNI
EPFITISHYEMPLYLVEKYGGWKNRKLIDFFYKFAETIFKRYKNKVKYWLTFNELNFTLS
IPFTGAGLLEENNKTKYQALNHQLIASAMTVKLCHDIIKDSKIGCMISYSPIYPDTPNPE
DVFACLKEQRKLTLCPDIQVNGEYPFYAKKLFEELGIVIDKEDENIIKSTVDFIGFSYYS
SKVISSDISKKQLVSGNMQKGVRNNYLKTSEWGWQIDPLGLRITLNNLYDRYKKPLFIVE
NGLGALDTLTEDMKVHDDYRIEYIKQHLLEVYNAIEDGVDLLGYLSWGPIDIISASTAEM
SKRYGYIYVDKDNKGNGSLKRIKKDSFAWYSEVIKTNGASLYNN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatgttttccaaaaggatttttatggggaggagctatatcagcaaatcaggct
gaaggagcatataatttagacgataaagggctttctacagcagatgtatcaccaaacggt
gtagtatttcctccaaaattaccttttgatagcaatatctataatccatttcatagcggt
atagatttttatcataattataaagaagatataaaactactagctgaacttggaataaat
tgttttagaacatctatagcttggactaggatttttcctacaggtatagaagacattcca
aatgaaaaggggttagagttttatgacaaattatttgatgaacttttaaaatataatata
gagccttttataacaatatctcattatgaaatgcctttatatttggtagaaaaatacggc
ggatggaaaaatagaaaactaatagactttttttataaatttgcagaaactatattcaaa
agatacaaaaacaaagtaaaatactggcttacattcaatgagcttaattttacattatca
ataccttttacaggtgcagggttattagaagaaaataataaaactaaatatcaggcactt
aatcatcaattaatagctagtgcaatgactgtaaagctttgccatgatattataaaagat
tcaaaaataggctgtatgatttcatattctccaatatatcctgatacacctaatcctgaa
gatgttttcgcatgtttaaaagaacagagaaaattaacattatgtcctgatattcaagta
aatggagaatatcctttttatgctaaaaaattatttgaagagcttggtattgttattgat
aaagaagatgagaacataattaaaagcactgtagatttcataggttttagttattattca
agtaaagttattagttctgatatttcaaaaaagcaattagtttcaggaaatatgcaaaaa
ggcgtaagaaacaattatcttaaaaccagcgaatggggttggcaaatagaccctttagga
ttaagaattactttgaataatttatatgacagatataaaaaaccattattcatagtagag
aatggtcttggtgctttagatacacttacagaagatatgaaagtgcatgatgattataga
atagaatatattaagcagcatcttttagaagtatacaatgctatagaagatggagtcgat
ttattaggatatttaagctggggacctatagatattataagtgcatctactgctgagatg
tcaaaaaggtacggatatatttatgttgataaagataataaaggaaatggttctttaaaa
agaattaaaaaagatagttttgcttggtactcagaggttataaaaactaatggggcaagt
ttatataataattaa

DBGET integrated database retrieval system