KEGG   Brachyspira pilosicoli WesB: WESB_0224Help
Entry
WESB_0224         CDS       T02412                                 

Gene name
ipk
Definition
putative 4-diphosphocytidyl-2-C-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bpw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(234401..235258)
Genome map
AA seq 285 aa AA seqDB search
MTELKSPCKVNLFLDITSKREDGYHLIESLFHTVDLYDIIEIKESNSFKITTSGKYKLND
NNEDNILSRIFFFFKDNMNLKKSYKINIEKNIPNGAGLGGGSSNAGLFIKFILKELEIKE
NEQLIKSFSKFGADIPFFIKRGMSWVNGIGENISHYNYILPYKIIIIYPNIHVSTKVAYS
NFKTEDFNKADFLSFKSIFDNKELDFNNIYNNLYNVFENNVFGLEPKIKEYKEQIENKIN
KKIVMSGSGSSLFTLYDNDDKKIENDYNILKEEFPHLDVFKLALI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattaaaatctccttgcaaagtaaacttatttttggatatcacatcaaaaaga
gaagacggatatcatttaatagaatctttatttcacactgttgacctttatgatattata
gaaataaaagaatcaaactctttcaaaattacaacctctggaaaatataaactaaatgat
aataatgaagataatatactttcaagaatatttttcttttttaaagataatatgaatcta
aaaaaaagttataaaataaatatagaaaaaaacataccaaacggtgctggtcttggagga
ggttcttctaatgccggactatttattaagtttatattaaaagaacttgaaataaaagaa
aatgaacagctaataaaatctttttctaagtttggagcagatattccattttttattaaa
agaggtatgagttgggttaatggcataggggaaaatatttcacattataactacatactt
ccatataaaataataataatatacccaaatatacatgtatctacaaaagttgcttattca
aattttaaaacagaagattttaacaaagcagactttttatcttttaaatctatatttgat
aataaagaattagattttaataatatttataataatttatataatgtttttgaaaacaat
gtatttggtcttgagccaaaaataaaagaatataaagaacaaatagaaaacaaaataaat
aaaaaaatagtgatgagcggttctggttcttctttatttactctgtatgataatgatgat
aaaaaaatagaaaatgattacaacatattaaaagaagaatttcctcatttagatgtattt
aaattagcattaatatag

DBGET integrated database retrieval system