KEGG   Brachyspira pilosicoli WesB: WESB_0265Help
Entry
WESB_0265         CDS       T02412                                 

Definition
AP endonuclease
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpw00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpw00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277138..278058)
Genome map
AA seq 306 aa AA seqDB search
MNFAGRINSLKGKMQDLSIAIEKLKKIKGITHIDLNYPEHFSNNDISEIKKSMGGLKLNG
ISTRFKEEFIHGEFINKDKKIRQNAIDLCKRAIDICQELDGEYLTIWCAYDGFDYPFQID
YERSWNNTISALQEISDYSKKVKISFEYKPYEPRAFSLLDSIGHVLTAISDTKRDNIGVT
LDFCHMIMKKENPAYSLALAAMRNKLYGLHMNDGYGSIDNGLIFGSISLSQALEFVYYLI
KYKYDGVVFFDSFPVREDASKEIESNINIFNKMVEIINSLGEKHIEEMISHQDAIEVSNM
LIKILK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgctggaagaattaattcattaaaaggtaaaatgcaagatttatctatagct
atagaaaaattaaaaaagataaaagggataactcatatagatttgaactatcctgaacat
ttttctaacaatgatatatcagaaataaagaagagtatgggcggacttaaattaaatggt
atttctactagatttaaagaagaatttatacatggggaattcataaataaagataaaaag
ataagacaaaatgctatagatttatgcaaaagggctatagatatatgtcaggaactagat
ggagaatatttaactatatggtgtgcttatgatggttttgattatccttttcaaatagat
tatgaaagaagctggaataacacaatatctgctttgcaagaaatttcagattattctaaa
aaagtaaagataagttttgaatacaagccatatgaacctagagctttttcattattagat
agtataggtcatgtattaactgctatttcagatacaaaaagagataacataggtgtaact
ttagatttttgtcatatgataatgaaaaaagagaatccggcttattcattagctttagct
gctatgaggaataaattatatggtttgcatatgaatgatggatatggaagtatagataat
ggattaatatttggttctataagtttaagtcaggcattagaatttgtatattatttgatt
aaatataagtatgatggtgttgtattttttgattcttttccggtgagagaggatgcttct
aaagagatagaatccaatattaatatatttaataagatggtagaaataattaattcttta
ggagaaaaacatatagaagaaatgatatctcatcaagatgctatagaagtttcaaatatg
cttataaaaattttaaaataa

DBGET integrated database retrieval system