KEGG   Brachyspira pilosicoli WesB: WESB_0287Help
Entry
WESB_0287         CDS       T02412                                 

Definition
Fructose-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bpw01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpw00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bpw00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpw00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpw00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302893..304836
Genome map
AA seq 647 aa AA seqDB search
MKDKDYLELLSQKYPTIDDASVEIINLKAICKLPKGTEYFLSDIHGESEGFEYLIGTSSG
VIKEKIEILFRNTLTENERIELQILIVDTKNMINKKASKEDFNDWCRITIYRLIRICKLV
TSKYTRSKIRKKMPQNFAYILDELLQTSVEDNKENYYFSIIDSIIDVSASEKFIMALCAL
IRKCSIDRLHIVGDIYDRGPHPDKVIESIMNFNEVDMAWGNHDIHWLGAAKGSLICVANA
VRLAVRYNNFDLLEYSYGINLRALSSFANEVYKDDPCEVFKPNTLDKNIYDEVDKDLASK
MHKAISIIQFKLECQLIKRHPNYAMDERILLDKIDYKKGTINIDGKTYELKDKNFPTINP
KNPFELTEGENTLIQSLAFSFINSPTLQKHTNYIYAKGGIYKIFNGNLLYHGCIPTKEDG
SFDDVYIDGQYLSGKRYLKQVEDKVRKAFYCEVGSEEQLNALDYCWYLWCGPKSPLFGKN
KMTTFERYFIEDKETHKESYNSYYYHIDKKDYCESILKEFDLDIHKSHIVNGHVPVKTHK
GESPIKGGGILLVIDGGLSKAYHKSTGIGGYTLISNSNAMIIAEHRPFAEVVESGFRISP
KTTIVDRFVTRITVGETDIGIGLNKRISDLEELLNAYRNGIVKEKVN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaggattatttagagttattatctcaaaagtaccccactatagatgatgct
tctgttgaaattattaatttaaaagctatatgcaaattgccaaagggtacagaatatttt
ttaagcgatatacatggagaatctgaaggctttgaatatttaataggcacttcatctggt
gttataaaagagaaaatagaaatattatttagaaatactttaacagaaaatgagagaata
gagcttcaaatacttatagtagatacaaagaatatgattaataaaaaagcatctaaagaa
gattttaatgattggtgcagaataactatatacagacttattagaatatgcaagcttgtt
actagtaaatatacaaggtcaaagattagaaagaagatgcctcagaactttgcttatata
cttgatgaacttttacaaacatctgttgaagacaataaagagaattattatttttctata
atagattctataatagatgtgtctgcatcagaaaagtttattatggcattatgtgctttg
ataagaaaatgcagtatagacaggcttcatattgtaggcgatatttatgacagaggacct
cacccagataaggtaattgagagtataatgaactttaatgaagttgacatggcttggggc
aatcatgatatacattggcttggtgctgctaaggggagtttaatttgtgttgctaatgct
gttcgtttggctgtgagatataataattttgatttgcttgaatatagttatggcataaat
ttaagggctttatcatcatttgctaatgaggtttataaagatgacccttgcgaagtgttt
aaacctaatactctagataaaaatatatatgatgaggttgataaagatttagcttcaaag
atgcataaggctatatcaataatacagtttaagttggaatgtcagcttataaaaagacac
ccaaattatgctatggacgaacgtatacttcttgataagattgattataaaaaaggcact
attaatattgacggtaaaacctatgagcttaaagataaaaactttccaacaataaatcct
aaaaacccttttgagcttacagaaggagaaaatactttaatacagagtttagctttttct
tttatcaatagcccaacacttcaaaagcatactaattatatttatgctaaaggcggaata
tataaaatatttaatggaaaccttctttatcatggatgcatacctacaaaagaagacggc
agttttgatgatgtatatatagatggacaatatttatctggaaagagatatttaaagcaa
gttgaagacaaggtacgtaaagcattttactgcgaagttggaagcgaagaacagcttaat
gctttggattattgctggtatttatggtgcggtccaaaatctccattattcggtaaaaat
aaaatgacaacttttgaaagatattttatagaagataaagaaactcataaagaaagttat
aattcatattattatcatatagacaaaaaagattattgcgagagcatattaaaagagttt
gatttggatatacataaatcgcatatagttaatgggcatgtacctgtaaagactcataaa
ggtgaaagcccaattaaaggcggtggaatacttttagtaatagacggaggactttctaag
gcctatcataaaagcacaggcataggaggctacactttaatatcaaactccaatgccatg
attatagcagagcatagaccttttgctgaagtagtggaatccggttttagaatatctccg
aaaacaactatagtagatagatttgtaactagaattacagtaggtgaaactgatattggt
attggcttaaacaaaagaataagtgatttggaagaattactcaatgcatatagaaacggt
atagtaaaagagaaggtgaattga

DBGET integrated database retrieval system