KEGG   Brachyspira pilosicoli WesB: WESB_0406Help
Entry
WESB_0406         CDS       T02412                                 

Gene name
pfkB1
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WESB_0406 (pfkB1)
Enzymes [BR:bpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     WESB_0406 (pfkB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(421806..422675)
Genome map
AA seq 289 aa AA seqDB search
MSKSILVIGSINKDLVVNTLRFPKEGETILGNNFYTTNGGKGANQACAIGKLGGDVSMLG
AVGNDNFAKDLSDALSSNNVNINNLLIKDNVSTGIAVITVTNDGANHIIVVQGANALITK
DDVKEDLISSFDIIVMQLEIPLEIAKYAASIAKKLGKTVVLNPSPAVKLDRDFLSCVDIL
IPNETEIDIIGGVDYVLECGVKNIILTLGADGCELITKQNRKHFDAYKVNVVDTTAAGDS
FLGGVVRMIADDKTIEEAIEFATKVSNITVTRKGAIDSIPTYNEVIDNY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaagtattttagtaataggaagtataaataaagatttagttgttaatactttg
cgtttccctaaagaaggcgaaactatacttggcaataatttttatactactaatgggggt
aagggggcaaatcaggcatgtgctataggtaaactaggcggtgatgtaagcatgctgggt
gctgttggaaatgataattttgctaaagatttatcagatgctttatcttcaaataatgtt
aatataaataatctattaataaaggataatgtttccactggcatagcggttattacagtt
actaatgatggagctaatcatattattgtagtacaaggagctaatgctttgattacgaaa
gatgatgttaaagaagatttgatttcatcatttgatataatagttatgcagttggagata
cctttagaaatagcaaaatatgctgcatctattgctaaaaaacttggtaaaactgttgtg
ttaaatccttcccctgctgtaaaactagatagagatttcttaagctgtgtagatatacta
attccaaatgaaacagaaatagatattataggcggtgttgattatgtacttgaatgcgga
gttaaaaatataatacttactttaggtgctgatggatgcgagcttataacaaaacaaaac
agaaaacattttgatgcatataaagttaatgttgttgatactactgctgcaggagacagt
tttttaggcggagttgtaagaatgattgctgacgataaaactattgaagaggctattgaa
tttgctactaaagtttctaatataactgttactagaaaaggagcaatagattctatacct
acatataatgaagtaattgataactattaa

DBGET integrated database retrieval system