KEGG   Brachyspira pilosicoli WesB: WESB_0464Help
Entry
WESB_0464         CDS       T02412                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487033..488418
Genome map
AA seq 461 aa AA seqDB search
MKQYRFKDNFLFGSSTSGPQSEGFYDKANKSIWDYWFEIAPDKFHNKVGPVYTSNFFRYY
KEDIKLIKETGHNVFRTSIQWSRIIKNFNTLELDEKAVEFYNNVIDELIKNDIEPIMCLY
HFDMPLKLQEIGGFENREVVELYAKYASKMFELYGDKVKKWFTFNEPIVVAEGGYLYKFH
YPEVVSFKRAIQVAYNMNLASAKAVKAFKESGKTGDIGIILNLTPSYPRDENNKEDLKAS
HICDLLFNRSFLDPAAKGEFPEDLVKFVKENNLTPICEQGDKELLKENTITLLGINYYQP
RRVKARETEFKSDTLMPENFFEPYEMPNRLMNPYRGWEIYYKGIYDIAKNIQDNYSNMRW
LITENGMGVENEERFIKEGVVEDDYRIEFVTEHLKWLHKAIEEGSNCLGYLMWTPIDCWS
WLNSYKNRYGFIRLDLETGKKTIKKSGYWFRELVKNKGFDA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatatagatttaaagataattttttatttggaagctctacatcaggacctcaa
agtgaaggtttttatgataaagctaataaaagcatatgggattattggtttgaaatagca
ccagataaattccataataaagtaggtccagtatatacatctaatttctttagatattat
aaagaagatataaaattaataaaagaaacaggacataatgtttttagaacttcaatacaa
tggagcagaataataaaaaattttaacactctagagttagatgaaaaagcagttgagttt
tataataatgttatagatgaacttataaaaaatgatatagagcctataatgtgtttgtat
cattttgatatgcctttaaaacttcaagagattggcggatttgaaaatagagaagttgtt
gaactctatgctaaatatgcttctaaaatgtttgaactatatggagataaagtaaaaaaa
tggtttacattcaatgagcctatagttgttgctgagggaggatatttgtataagtttcat
tatcctgaagttgtatcatttaaaagggctattcaagtagcttataatatgaacttggct
agtgcaaaggctgtaaaagcatttaaagaatctggaaaaactggagatataggaataata
ttaaacttaactccttcttaccctagagatgaaaacaataaagaagatttaaaagcttca
catatatgcgatttattgtttaatagaagttttttagaccctgctgctaaaggagagttt
ccagaagatttagtaaaattcgtgaaagaaaataaccttactcctatatgcgaacaaggc
gacaaagaattattaaaagaaaatactataactttgcttggaataaattattatcagcct
agaagagtgaaggcaagagagacagagtttaaatcagatactttaatgcctgaaaacttc
ttcgagccttatgaaatgcctaacagacttatgaatccatacagaggctgggaaatatat
tataaaggtatttatgatatagcaaaaaatattcaagataattattctaatatgagatgg
ctaataacagaaaatggaatgggtgttgaaaatgaagagagatttataaaagaaggcgtt
gtagaagatgattatagaatagagtttgtaacagaacatttaaaatggcttcacaaagca
atagaagagggttctaattgtcttggttatttaatgtggacacctatagattgttggtct
tggcttaattcttataaaaatagatatggatttattcgcttagatttagaaacaggaaag
aaaacaataaagaaatcaggatattggtttagagagcttgtaaaaaataagggctttgat
gcttaa

DBGET integrated database retrieval system