KEGG   Brachyspira pilosicoli WesB: WESB_0464Help
Entry
WESB_0464         CDS       T02412                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WESB_0464
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     WESB_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487033..488418
Genome map
AA seq 461 aa AA seqDB search
MKQYRFKDNFLFGSSTSGPQSEGFYDKANKSIWDYWFEIAPDKFHNKVGPVYTSNFFRYY
KEDIKLIKETGHNVFRTSIQWSRIIKNFNTLELDEKAVEFYNNVIDELIKNDIEPIMCLY
HFDMPLKLQEIGGFENREVVELYAKYASKMFELYGDKVKKWFTFNEPIVVAEGGYLYKFH
YPEVVSFKRAIQVAYNMNLASAKAVKAFKESGKTGDIGIILNLTPSYPRDENNKEDLKAS
HICDLLFNRSFLDPAAKGEFPEDLVKFVKENNLTPICEQGDKELLKENTITLLGINYYQP
RRVKARETEFKSDTLMPENFFEPYEMPNRLMNPYRGWEIYYKGIYDIAKNIQDNYSNMRW
LITENGMGVENEERFIKEGVVEDDYRIEFVTEHLKWLHKAIEEGSNCLGYLMWTPIDCWS
WLNSYKNRYGFIRLDLETGKKTIKKSGYWFRELVKNKGFDA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatatagatttaaagataattttttatttggaagctctacatcaggacctcaa
agtgaaggtttttatgataaagctaataaaagcatatgggattattggtttgaaatagca
ccagataaattccataataaagtaggtccagtatatacatctaatttctttagatattat
aaagaagatataaaattaataaaagaaacaggacataatgtttttagaacttcaatacaa
tggagcagaataataaaaaattttaacactctagagttagatgaaaaagcagttgagttt
tataataatgttatagatgaacttataaaaaatgatatagagcctataatgtgtttgtat
cattttgatatgcctttaaaacttcaagagattggcggatttgaaaatagagaagttgtt
gaactctatgctaaatatgcttctaaaatgtttgaactatatggagataaagtaaaaaaa
tggtttacattcaatgagcctatagttgttgctgagggaggatatttgtataagtttcat
tatcctgaagttgtatcatttaaaagggctattcaagtagcttataatatgaacttggct
agtgcaaaggctgtaaaagcatttaaagaatctggaaaaactggagatataggaataata
ttaaacttaactccttcttaccctagagatgaaaacaataaagaagatttaaaagcttca
catatatgcgatttattgtttaatagaagttttttagaccctgctgctaaaggagagttt
ccagaagatttagtaaaattcgtgaaagaaaataaccttactcctatatgcgaacaaggc
gacaaagaattattaaaagaaaatactataactttgcttggaataaattattatcagcct
agaagagtgaaggcaagagagacagagtttaaatcagatactttaatgcctgaaaacttc
ttcgagccttatgaaatgcctaacagacttatgaatccatacagaggctgggaaatatat
tataaaggtatttatgatatagcaaaaaatattcaagataattattctaatatgagatgg
ctaataacagaaaatggaatgggtgttgaaaatgaagagagatttataaaagaaggcgtt
gtagaagatgattatagaatagagtttgtaacagaacatttaaaatggcttcacaaagca
atagaagagggttctaattgtcttggttatttaatgtggacacctatagattgttggtct
tggcttaattcttataaaaatagatatggatttattcgcttagatttagaaacaggaaag
aaaacaataaagaaatcaggatattggtttagagagcttgtaaaaaataagggctttgat
gcttaa

DBGET integrated database retrieval system