KEGG   Brachyspira pilosicoli WesB: WESB_0579Help
Entry
WESB_0579         CDS       T02412                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WESB_0579
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WESB_0579
   00052 Galactose metabolism
    WESB_0579
   00500 Starch and sucrose metabolism
    WESB_0579
   00520 Amino sugar and nucleotide sugar metabolism
    WESB_0579
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WESB_0579
   00524 Butirosin and neomycin biosynthesis
    WESB_0579
Enzymes [BR:bpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     WESB_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614374..615327
Genome map
AA seq 317 aa AA seqDB search
MKDAVIALDIGGTSIKGAIINEEGNILYKDSFNIEANFTSEEHKTNIANIIKKLLENMPS
EYNAIGIGLDCPGVMNSETLHMGGAENVPGLHGIKFSDIGDLFDLPIKTANDASMAALGE
AKYGSGKDKEYKSVMFITLGTGVGGGFVFNGKLFTGSLGGAGEVGHVFVVPDGDKCNCGS
SGCIERYASATGFIAMAKQKIHKNVVPTTLTYEELEKGKAKAIFDAAKKGDALAKETIAE
CSYYLGMSIAQALNMLDLDLVLIGGGLCKDFDMMIEHIKRGVNNYALRMMVRNLEIKPAS
LGNDAGVLGCAAMFFRN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgctgttattgctttagatataggaggcacttcaataaagggtgctataatt
aatgaagagggaaatattttatataaagatagctttaatatagaagctaattttacctct
gaagaacataagacaaatatagcaaatataataaaaaagcttttagagaatatgccttca
gaatataatgccataggaattggtttagattgtcctggagttatgaactctgagacgctt
catatgggaggagcagaaaatgttcctggtttgcatggcattaagttttctgatataggt
gatttatttgatttgcctataaaaactgccaatgatgctagtatggctgcattaggtgag
gctaaatacggaagcggtaaggataaagaatataaatctgtaatgtttattacacttggc
actggtgtaggcggaggatttgtatttaacggcaaattatttacaggttctttgggagga
gctggtgaagtagggcatgtatttgtagttcctgatggtgataaatgtaattgcggttca
agtggctgtatagagcgttatgcttctgctactggttttattgctatggctaaacaaaag
attcataaaaatgttgttcctactactttaacttatgaggaattagaaaaaggtaaggct
aaggctatatttgatgctgctaaaaaaggagatgctcttgctaaagagactattgcggag
tgttcttattatttaggtatgtctatagcacaggctttgaatatgcttgatttggatttg
gttcttataggcggcggtctttgtaaagattttgatatgatgatagagcatattaaaaga
ggcgttaataattatgctcttagaatgatggtaagaaatcttgaaataaaacctgcttct
ttaggaaatgatgccggtgtattaggctgtgctgctatgttttttagaaattaa

DBGET integrated database retrieval system