KEGG   Brachyspira pilosicoli WesB: WESB_0795Help
Entry
WESB_0795         CDS       T02412                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpw01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(850643..851797)
Genome map
AA seq 384 aa AA seqDB search
MFCMKNIDLNNIKRIVFKFGTNVLRNDEGYISLARIYSFIEAIAKYKKMGKEVLVVTSGA
VGLGAKKINATDLSEVSLKQACAAIGQSQLMSIYEDGFSKFDIVTAQILLTEEDFSNRRR
YLNLRSTLDTLLKYNVIPIINENDTVSSDELKLLYDVTQISFSDNDKLSALVASELDADL
LIILSDINGLYDDNPKTNPNANFIHEVFEVTKEIESLGLDASKGGRGGMKTKLQAAKIVT
RSGCGLIIANGKTPNILNNIFNTKEKTIFYPVEENNELNTKKRWIAYATTIIGKLVVNAG
AKKAIIEKESSLLPIGVTKVVNNFKKGDIVSIIDEDGEEFARGIINYNSEDTNKIIGKHS
DSILEILGYKNYDALITRDYIVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcatgaaaaatatagatttaaacaacataaaaagaatagttttcaaatttgga
actaatgtattaagaaatgatgaaggatatatttctttagctagaatatattctttcata
gaggctatagctaaatataaaaaaatgggcaaagaagttttagttgttacatctggagct
gttggcttgggagcgaaaaaaattaatgcaacagatttaagcgaagtatcactaaaacaa
gcatgtgctgcaattggacaatcacagcttatgtctatttatgaagatggattttcaaag
tttgatattgttacagcacagattctgcttacagaagaagacttttcaaacagaagaaga
tatttaaatttgcgttctactttagacacattattaaaatacaatgtaatacctataatc
aatgaaaatgatactgtttctagtgatgagcttaaattattatatgatgttactcaaata
agtttttctgataatgataaactatctgcattagtagcaagtgagcttgatgctgattta
ctcataatactttctgatatcaatgggctttatgatgataaccctaaaactaacccaaat
gctaattttatacatgaagtttttgaggttacaaaagaaatagaaagtttaggtcttgat
gcttctaaaggcggaagaggcggaatgaaaacaaaattgcaggctgccaaaattgttaca
aggtcaggctgcggtttgattattgctaatggaaaaactccaaacattttaaataatata
ttcaatacaaaagaaaaaactatattctaccctgtagaagaaaacaatgaacttaacaca
aaaaaaagatggattgcttatgctacaactattataggaaaacttgttgtaaatgctggt
gctaaaaaagctataatagaaaaagaatctagtcttcttcctattggcgtaacaaaggtt
gtaaacaattttaagaaaggcgacattgtaagcattatagatgaagatggtgaagagttt
gcaagaggcattattaattataattctgaggatacaaataaaatcataggcaaacattct
gattctatattagagatattaggctacaagaactatgatgctctaattacaagagattat
atagtgttattataa

DBGET integrated database retrieval system