KEGG   Brachyspira pilosicoli WesB: WESB_0854Help
Entry
WESB_0854         CDS       T02412                                 

Definition
formamidopyrimidine D-glycolase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bpw03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(915418..916071)
Genome map
AA seq 217 aa AA seqDB search
MKELPYLINLINALKGEICYSYINNVVALDKKYKELEEVKGQKIIDVLRHGGYMHFQFSQ
DAMLVDLGSGGSFVLTENNTYKNAIIKLETDNGNFFVVDESKDKDDATHIIPIWKDYTTM
PQVGYDPLTKQFNYNLFCQLLADNATTVEKLIKNPLIISGIGDTYGDMILKRASITKRTK
TTDINKAKAREIFDAIKQVLREASGNRDEEESEDSED
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactaccatatttaatcaatttaattaatgcattgaagggcgagatttgttat
tcttatattaataatgttgttgctttagacaaaaaatataaagagcttgaagaagttaaa
ggacaaaaaattatagatgtattaagacatggcggatatatgcattttcaattctcacaa
gatgctatgcttgtagacttgggttctggaggctcttttgtacttacagaaaacaacact
tataaaaatgcaataatcaaactagaaactgataatggcaacttctttgttgtagatgag
agtaaagataaagatgatgctacacatattatacctatatggaaagattatactacaatg
cctcaagtaggttatgaccctctcactaaacaatttaattataatttattctgtcaatta
cttgcagataatgccacaactgtagaaaaacttattaaaaaccctctcataataagcggt
ataggagacacttacggagatatgatattaaaaagggcttctattactaaaaggactaaa
actacagatataaacaaagcaaaagcaagagaaatttttgatgctataaaacaagtattg
agagaggcttctggaaatagagacgaagaagaaagcgaagattctgaagattaa

DBGET integrated database retrieval system