KEGG   Brachyspira pilosicoli WesB: WESB_1069Help
Entry
WESB_1069         CDS       T02412                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    WESB_1069
  Lipid metabolism
   00561 Glycerolipid metabolism
    WESB_1069
   00600 Sphingolipid metabolism
    WESB_1069
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     WESB_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162292..1164484
Genome map
AA seq 730 aa AA seqDB search
MISIIENHKKRKLFFLNTISSSLVLMVHEDNYIFIPYWGAKIEASNIDYIIDEITEANYM
AYTDNRKKFQLEVIPQIYPSYGYTDLKEPAFHFLHRDGSRITDLRYKSHNIYKTKKKLEG
LPTVLSDEHSEVLELVLFDELKKIEVTITLAVFEKYNAITKSVKVINKHETDSLYIEKIM
SANIDLQESNFELLHLSGAWGRECHIKRRKLEQGMQSIGSVRGASGHGQNPFAALISPNA
DENNGKVYAMNFVYSGNFKASVEVDMHLNTRFQMGINDFDFGWTLMPNEEFQTPEAVLVY
TNKGLGDMSRTFHKLYQDCLMSKKYAYKERPILINSWESNYFDFNKESLLKLAKEAKNIG
AELFVLDDGWFGKRDDDKSSLGDWIPNEKKLGGSLSALIDDINKTGLSFGLWFEPEMVSP
DSDLFRKHPEWAIQVKGRKIETSRYQYVLDLSNPEVCGYIINFMTDILSKNNISYVKWDM
NRNITNLGSSYLKPEKQKEQSHRYMLGLYSVLENIVNAFPNILFESCAGGGGRCDAGMLY
YMPQVWTSDDTDAIERLAIQYGASLIYPSISLACHISDIPNHQTHRKETIKTRANVAMWG
NLGLELNLNKISEEDKKNISEKLEVYKLIRSTVQFGSLYRLKGLDYGNEYAWLHKSIDEK
TIVVNYVQINMVPNLLTKRLRLEALEPKSKYKVNDSDKIYTGEELMNIGLVLGEIVEDAI
AIQWIIKKID
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgattagtattatcgaaaatcataaaaaaagaaaactattctttttaaacactatctca
tcatctttagtattaatggttcatgaagataattatatatttattccttattggggggca
aaaatagaggcaagcaatatagattatattattgatgaaataactgaagctaattatatg
gcatatactgataatagaaaaaaatttcagcttgaagtaatacctcaaatatatccttct
tacggttacacagatttaaaagaaccagcatttcattttctacatagagacggttcaaga
ataacagacttgcgttataaatcacataacatatataaaactaaaaagaaattagaagga
cttcctacagtgttatcagatgagcatagtgaagtattagaattagttttatttgatgag
ttgaaaaaaattgaggtaacaattactttagctgtatttgaaaaatataatgcaataaca
aaatcagtaaaagtaataaataaacatgaaacagattctttatacatagaaaaaataatg
tcagcaaatatagaccttcaggaatcaaattttgaattgcttcatttgtctggtgcttgg
ggaagagaatgtcatattaagagaaggaaattagagcagggaatgcagtctataggaagt
gtgagaggtgcatcagggcatggtcaaaacccatttgctgctttaatatctcctaatgct
gatgaaaataatgggaaagtatatgctatgaatttcgtatacagcggaaattttaaagca
agtgttgaagtggacatgcatttaaatactagatttcaaatgggaataaatgattttgat
tttggttggacattaatgcctaatgaagagtttcaaactcctgaagctgtgcttgtatat
acaaacaaaggtttaggtgatatgtcgagaactttccataaactttatcaagattgtttg
atgtcaaaaaaatatgcttataaagagcgtcctattttgataaacagttgggaatccaat
tattttgattttaataaagaaagtcttttaaaattagctaaagaggcaaaaaatatagga
gctgaattatttgtattagatgatggttggtttggaaaaagagatgatgataaaagttct
ttgggagattggatacctaatgaaaaaaaacttggcggaagtttgtctgctttgatagat
gatataaataaaactggattaagttttggattatggtttgaacctgaaatggtatctcct
gatagtgatttatttagaaaacacccagagtgggctattcaagttaaaggcagaaaaata
gagacttcaagatatcagtatgtattagatttaagtaatcctgaagtatgcggctatata
ataaactttatgactgatattttatcaaaaaataatatttcttatgttaaatgggatatg
aatagaaatattacaaatttaggttcatcttatctaaaacctgaaaagcaaaaggaacaa
tctcatagatatatgttaggtctttacagtgtattagaaaatattgttaatgcatttcct
aatatattatttgaaagctgtgcaggaggcggcggaagatgcgatgctggtatgctttat
tatatgcctcaggtttggacaagtgatgatactgatgctatagaaagactcgctatacaa
tatggagcttctttaatttatccttcaatatctttagcttgccatatttctgatatacct
aatcatcaaacacataggaaggaaactataaaaacaagagcaaatgttgctatgtggggt
aatttgggattagaattaaacttaaataaaataagtgaagaagataaaaaaaatatatca
gaaaaattggaagtttataaactcataagaagtactgttcagtttggaagtctttacaga
ttaaaaggtttagattatggtaatgaatatgcttggcttcacaagagtattgatgaaaaa
actatagttgtaaattatgtgcaaataaatatggttcctaatttattaacaaagcgtttg
cgtttagaggcattagagcctaaaagtaaatataaagtaaatgactctgataaaatctac
actggagaagagttaatgaatattgggcttgtgcttggagagatagtggaagatgctata
gctattcaatggataataaaaaagattgattaa

DBGET integrated database retrieval system