KEGG   Brachyspira pilosicoli WesB: WESB_1090Help
Entry
WESB_1090         CDS       T02412                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WESB_1090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WESB_1090
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    WESB_1090
Enzymes [BR:bpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     WESB_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188420..1189475
Genome map
AA seq 351 aa AA seqDB search
MKAWNGLLREYREYLPITDKTPLITLHEGNTPLIKAEKIGKELGGIELYFKYDGLNPTGS
FKDRGMVMAVAKALEDGSKAIMCASTGNTSASAAAYAARSGIQCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDTLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGNVSNLPKMIGFEAEGSAAIVQNRVIENPQTLAT
AIKIGNPASWKLAVNAANESNGFIDSVTDDEILEAYKMLTREEGIFAEPASAASLAGVIK
TYKAGKLKKGDVVVSVLTGNGLKDPDNAIKICSAPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatggaacggacttttaagagaatatagagaatatttaccaattacagataaa
accccattaataacattgcatgaaggaaatactccattaataaaagcagaaaagatagga
aaagaacttggaggcatagaattatatttcaaatatgacggacttaaccctacaggttca
tttaaagacagaggaatggtaatggcagttgctaaggcacttgaagatggttcaaaggct
ataatgtgtgcttctactggaaacacttctgcatctgctgctgcctatgctgctagaagc
ggtatacaatgtatagtggttattccagatggaaatattgctttaggaaaattagcacag
gctttgatgtatggtgctaaggttatagctattaaaggtaattttgatgaagcattaaaa
gctgttgttgatattacaaataaatacccaatcacattggtaaactctattaaccctttt
aggcttcaaggtcaaaaaacttctgcatttgagatttgcgatactttaggaaaagctcct
gattatttggctatacctgttggaaatgctggaaatatatctgcatattggatgggtttt
aaagaatataaagaaaacggaaatgtatcaaacttaccaaagatgataggttttgaggct
gagggttctgctgctatagtacaaaacagagttatagaaaatcctcagacattggctact
gctataaagataggtaatcctgctagttggaagttagctgttaatgctgctaatgaatct
aatggttttatagactctgttactgatgatgaaatattagaggcttacaaaatgcttaca
agagaagagggtatatttgctgagcctgcttctgctgcttctttggctggagttataaaa
acttacaaagcgggtaaacttaaaaaaggtgatgttgtagtttctgtacttacaggaaat
ggacttaaagaccctgataatgcaataaagatttgttctgctcctataaaagttgataat
aatatagaagagataagaaaagctataggaatatga

DBGET integrated database retrieval system