KEGG   Brachyspira pilosicoli WesB: WESB_1396Help
Entry
WESB_1396         CDS       T02412                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpw00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpw00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532698..1534011
Genome map
AA seq 437 aa AA seqDB search
MEYFKNVDKVSYKGKDSKDAFSFKQYNASEVIAGKTMEEWMPFAMSWWHTLAAGSADPFG
VPAATRPWNGKEALEASKMRVEAGFELMQKLGMNYFCFHDRDLSPEYKTLKETNEKLDMI
VDLIQESMSKTGKKLLWATSSLFTNPRYMHGAATSPYADVFAVAAAQTKKTMDIAKKLDA
KGYVFWGGREGYETLLNTNMKRELDHLAYFLSMAVEYKEKIGFKGQFFIEPKPKEPTKHQ
YDFDAATTLEFLYHYNLDKYFELNLEVNHATLAGHTMQHEMQVARNHGKLGSVDINYGDT
FLGWDTDMFLTNVYDAVLMMVEIIRNGGLRNGGFNFDAKVRRPSHTMDDLMYAYIAGMDT
LAWGLRIANKIIEDGCFDKFVEERYSSYNSGIGAKIESKSTSLEELYDYALALEEKELPS
GNQELLEAKLNQFIYNL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggaatattttaaaaatgttgataaagtatcatataaaggaaaagatagtaaagatgct
ttttcattcaaacaatataatgcttcagaagttatagctggaaaaactatggaagagtgg
atgccttttgcaatgagttggtggcatacattggctgctggaagtgcagatccttttgga
gttcctgctgcaactaggccttggaatggaaaagaggcattagaagcttctaaaatgaga
gtggaagctgggtttgaacttatgcaaaaattaggaatgaattatttttgctttcatgat
agggatttatctcctgaatataaaactttaaaagagactaatgaaaaattagatatgata
gtagatttgatacaagaaagtatgtctaaaacaggtaagaaactcttatgggctacttca
tctttattcacaaaccctagatatatgcatggtgctgctactagtccttacgctgatgtt
tttgcagttgctgctgctcaaactaaaaaaactatggatatagctaaaaagttagatgct
aaaggatacgtattctggggcggtagagaaggttatgaaactttacttaatactaatatg
aaaagagaattggatcatttagcttatttcttatctatggcagttgagtataaagagaaa
ataggatttaaaggacaattctttattgaaccaaaaccaaaagaaccaacaaaacatcaa
tatgattttgatgctgctactactttagagtttttatatcattataatttggataaatat
tttgaacttaatttagaagtaaatcatgctactttggcaggacatactatgcagcatgag
atgcaggttgctagaaatcatggaaaattaggttctgttgatattaactacggtgatact
ttcttgggttgggatacagatatgttcctaactaatgtatatgatgcagtattaatgatg
gtagagattataagaaatggcggattaagaaacggcggattcaactttgatgctaaagta
agaagaccatctcatactatggacgatttaatgtatgcttatattgcgggaatggatact
ttagcttggggattaagaatagctaataaaataattgaagatggttgttttgataagttt
gtagaagaaagatatagttcttacaatagcggaataggggcaaaaatagaaagcaaatca
acatcattagaagagttatatgattatgcacttgctttagaagaaaaagaacttcctagc
ggtaatcaagaattacttgaagctaaattaaatcaatttatttataatctataa

DBGET integrated database retrieval system