KEGG   Brachyspira pilosicoli WesB: WESB_1588Help
Entry
WESB_1588         CDS       T02412                                 

Definition
bifunctional pyrazinamidase nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    WESB_1588
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     WESB_1588
    3.5.1.-  
     WESB_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749846..1750487
Genome map
AA seq 213 aa AA seqDB search
MSKVKILTIVDMQNDYMEGGPMAVNGAIGLIPVINDLIKNGEYDAIIATQDWHPSNHISF
ASTHNKEPFSKIRVMDKETGDEDILTLWPRHCVARTFGSAIVDELKKKKDYIYVQKGVDA
DDEGVSGFSYMHKDFIDAARENKEVLILDFVGVALDYAVYYTARDTAQYVTSINAEYLVS
VNVLEYATAAMNPDKVYELYSNTKNINLKKVHL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggttaagatactaacaatagtagatatgcaaaatgattatatggaaggcggt
cctatggctgttaatggagcaattggacttatacctgtaattaatgaccttataaaaaat
ggagaatatgatgctataatagctactcaagattggcatccatcaaatcatatatctttt
gcttctactcataataaagaacctttttctaaaattagagtaatggacaaagaaactggc
gatgaagatattttaacactttggcctcgtcattgtgttgctagaactttcggctctgct
attgttgatgaattaaaaaagaaaaaagattatatttatgttcaaaagggtgttgatgct
gatgatgagggagtatctggattttcttatatgcataaggattttatagatgctgctaga
gaaaataaagaagtattgatattagatttcgtcggtgttgctttggattatgctgtttat
tatacggcaagggatacagctcaatacgtaacttctattaatgctgaatatttagttagc
gtaaatgttttagaatatgcaactgctgcaatgaatccagataaagtctatgaattatat
tccaatacaaaaaacattaatcttaaaaaggttcatctgtga

DBGET integrated database retrieval system