KEGG   Brachyspira pilosicoli WesB: WESB_1588Help
Entry
WESB_1588         CDS       T02412                                 

Definition
bifunctional pyrazinamidase nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpw00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749846..1750487
Genome map
AA seq 213 aa AA seqDB search
MSKVKILTIVDMQNDYMEGGPMAVNGAIGLIPVINDLIKNGEYDAIIATQDWHPSNHISF
ASTHNKEPFSKIRVMDKETGDEDILTLWPRHCVARTFGSAIVDELKKKKDYIYVQKGVDA
DDEGVSGFSYMHKDFIDAARENKEVLILDFVGVALDYAVYYTARDTAQYVTSINAEYLVS
VNVLEYATAAMNPDKVYELYSNTKNINLKKVHL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggttaagatactaacaatagtagatatgcaaaatgattatatggaaggcggt
cctatggctgttaatggagcaattggacttatacctgtaattaatgaccttataaaaaat
ggagaatatgatgctataatagctactcaagattggcatccatcaaatcatatatctttt
gcttctactcataataaagaacctttttctaaaattagagtaatggacaaagaaactggc
gatgaagatattttaacactttggcctcgtcattgtgttgctagaactttcggctctgct
attgttgatgaattaaaaaagaaaaaagattatatttatgttcaaaagggtgttgatgct
gatgatgagggagtatctggattttcttatatgcataaggattttatagatgctgctaga
gaaaataaagaagtattgatattagatttcgtcggtgttgctttggattatgctgtttat
tatacggcaagggatacagctcaatacgtaacttctattaatgctgaatatttagttagc
gtaaatgttttagaatatgcaactgctgcaatgaatccagataaagtctatgaattatat
tccaatacaaaaaacattaatcttaaaaaggttcatctgtga

DBGET integrated database retrieval system