KEGG   Brachyspira pilosicoli WesB: WESB_1633Help
Entry
WESB_1633         CDS       T02412                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WESB_1633
Enzymes [BR:bpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     WESB_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807599..1808753
Genome map
AA seq 384 aa AA seqDB search
MKKRVLILGATGSIGVNTCSVIEHFYNDFEIVGITTNTKIDVLKEECMKFKPKYVHISSK
EALEKFKKFNINVNIYEGSIADFVRDIDFDILVNALVGYSGFLPTIEAIKKSKVVALANK
ETLVVGGDIINDLLKKHNAKLVPIDSEHSAIFQILNHFKNVPISKVIITASGGPFFRTPK
EELKNVTVEMALKHPTWNMGGKITIDSATMMNKGFEVIEAHHLFNLDYDKIETIIHPQSL
IHSMVEFVDGEIYAQIGKNDMRLPIQHALTYPEVRTTPFEKLKLYEHSEINFYKMDFDKF
IMLKLAYECGKKGGLYPCILNAANEVCVYSFLEKKISFTEIFDIVEKMVKINVDQIPLTV
ENIIKIDNETRKETLKLIETIKQM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagttcttatacttggtgctactggttctataggagtgaatacttgctct
gtaatagaacatttttataatgattttgaaatagtaggaatcaccacaaatacaaaaatt
gatgttttaaaagaagaatgcatgaaattcaaaccaaaatatgtgcatatatcttctaaa
gaagcattagaaaagttcaaaaaatttaatatcaatgttaacatctatgaaggaagcata
gctgattttgtaagagatattgattttgatatactagtaaatgctttagtaggatattct
ggttttcttccaacaatagaagcaataaaaaaatctaaagttgtagcattagcaaataaa
gaaacattagttgtaggcggcgatataattaatgatttattaaaaaaacataatgctaaa
ttagtaccaatagacagcgaacattctgcaatttttcaaatattaaatcattttaaaaat
gtaccaatatcaaaagtaataataacagcatcaggaggacctttctttagaactccaaaa
gaagagttaaaaaatgttacagtagaaatggcattaaaacacccaacttggaatatgggc
ggaaaaattacaatagacagtgccactatgatgaacaaaggttttgaagtaatagaagct
catcatttatttaatttggattatgacaaaatagaaactataatacaccctcaaagttta
atacattctatggttgagtttgtagacggagagatatatgctcaaattggaaagaatgat
atgcgtcttcctatacagcatgccctcacctacccagaagtaagaacaacaccatttgaa
aaattaaagctttatgaacatagcgagattaatttttataagatggattttgataagttt
attatgcttaaactcgcttatgaatgcggtaagaagggaggattatatccttgtatatta
aatgctgctaatgaagtatgtgtgtattcatttttagagaaaaaaatatcatttactgaa
atatttgatatagtagaaaaaatggtaaaaataaatgttgatcagataccgcttactgta
gaaaatattataaaaatagacaatgaaactagaaaagaaactttaaaattaatagaaact
ataaaacaaatgtga

DBGET integrated database retrieval system